LOCUS X07317 1284 bp DNA linear BCT 31-MAR-1995
DEFINITION Pseudomonas aeruginosa gene for blue copper protein azurin.
ACCESSION X07317
VERSION X07317.1
KEYWORDS azurin; blue copper protein.
SOURCE Pseudomonas aeruginosa
ORGANISM Pseudomonas aeruginosa
Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
Pseudomonadaceae; Pseudomonas.
REFERENCE 1 (bases 1 to 1284)
AUTHORS Lundberg L.
JOURNAL Submitted (01-FEB-1988) to the INSDC. Lundberg L., Dept. of
Biochemistry and Biophysics , Chalmers University of Technology,
S-412 96 Goeteborg, Sweden.
REFERENCE 2 (bases 1 to 1284)
AUTHORS Arvidsson R.H.A., Nordling M., Lundberg L.G.
TITLE Isolation and Characterization of the Azurin Gene from Pseudomonas
aeruginosa
JOURNAL Eur. J. Biochem. 179(1), 195-200(1989).
PUBMED 2537198
COMMENT part of the sequence (pos. 470-942) from strain CIT135 has been
determined earlier (FEBS Lett. 212, 168-172,1987) showing slight
differences
Data kindly reviewed (21-APR-1989)
FEATURES Location/Qualifiers
source 1..1284
/organism="Pseudomonas aeruginosa"
/strain="ATCC 10145"
/mol_type="genomic DNA"
/db_xref="taxon:287"
regulatory 317..332
/note="promoter P2"
/regulatory_class="promoter"
precursor_RNA 343..983
/note="minor transcript (0.54 kb)"
regulatory 410..445
/note="promoter P1"
/regulatory_class="promoter"
precursor_RNA 450..983
/note="major transcript (0.65 kb)"
misc_feature 450..456
/note="region of major transcription start"
regulatory 475..480
/note="pot. ribosome binding site"
/regulatory_class="ribosome_binding_site"
CDS 488..934
/transl_table=11
/note="pre-azurin (AA -20 to 128)"
/db_xref="GOA:P00282"
/db_xref="InterPro:IPR000923"
/db_xref="InterPro:IPR008972"
/db_xref="InterPro:IPR014068"
/db_xref="InterPro:IPR028871"
/db_xref="PDB:1AG0"
/db_xref="PDB:1AZN"
/db_xref="PDB:1AZR"
/db_xref="PDB:1AZU"
/db_xref="PDB:1BEX"
/db_xref="PDB:1CC3"
/db_xref="PDB:1E5Y"
/db_xref="PDB:1E5Z"
/db_xref="PDB:1E65"
/db_xref="PDB:1E67"
/db_xref="PDB:1ETJ"
/db_xref="PDB:1EZL"
/db_xref="PDB:1GR7"
/db_xref="PDB:1I53"
/db_xref="PDB:1ILS"
/db_xref="PDB:1ILU"
/db_xref="PDB:1JVL"
/db_xref="PDB:1JVO"
/db_xref="PDB:1JZE"
/db_xref="PDB:1JZF"
/db_xref="PDB:1JZG"
/db_xref="PDB:1JZH"
/db_xref="PDB:1JZI"
/db_xref="PDB:1JZJ"
/db_xref="PDB:1NZR"
/db_xref="PDB:1R1C"
/db_xref="PDB:1VLX"
/db_xref="PDB:1XB3"
/db_xref="PDB:1XB6"
/db_xref="PDB:1XB8"
/db_xref="PDB:2AZU"
/db_xref="PDB:2FNW"
/db_xref="PDB:2FT6"
/db_xref="PDB:2FT7"
/db_xref="PDB:2FT8"
/db_xref="PDB:2FTA"
/db_xref="PDB:2GHZ"
/db_xref="PDB:2GI0"
/db_xref="PDB:2HX7"
/db_xref="PDB:2HX8"
/db_xref="PDB:2HX9"
/db_xref="PDB:2HXA"
/db_xref="PDB:2I7O"
/db_xref="PDB:2I7S"
/db_xref="PDB:2IDF"
/db_xref="PDB:2IWE"
/db_xref="PDB:2OJ1"
/db_xref="PDB:2TSA"
/db_xref="PDB:2TSB"
/db_xref="PDB:2XV0"
/db_xref="PDB:2XV2"
/db_xref="PDB:2XV3"
/db_xref="PDB:3AZU"
/db_xref="PDB:3FPY"
/db_xref="PDB:3FQ1"
/db_xref="PDB:3FQ2"
/db_xref="PDB:3FQY"
/db_xref="PDB:3FS9"
/db_xref="PDB:3FSA"
/db_xref="PDB:3FSV"
/db_xref="PDB:3FSW"
/db_xref="PDB:3FSZ"
/db_xref="PDB:3FT0"
/db_xref="PDB:3IBO"
/db_xref="PDB:3IN0"
/db_xref="PDB:3IN2"
/db_xref="PDB:3JT2"
/db_xref="PDB:3JTB"
/db_xref="PDB:3N2J"
/db_xref="PDB:3NP3"
/db_xref="PDB:3NP4"
/db_xref="PDB:3OQR"
/db_xref="PDB:3U25"
/db_xref="PDB:3UGE"
/db_xref="PDB:4AZU"
/db_xref="PDB:4BWW"
/db_xref="PDB:4HHG"
/db_xref="PDB:4HHW"
/db_xref="PDB:4HIP"
/db_xref="PDB:4HZ1"
/db_xref="PDB:4JKN"
/db_xref="PDB:4K9J"
/db_xref="PDB:4KO5"
/db_xref="PDB:4KO6"
/db_xref="PDB:4KO7"
/db_xref="PDB:4KO9"
/db_xref="PDB:4KOB"
/db_xref="PDB:4KOC"
/db_xref="PDB:4MFH"
/db_xref="PDB:4QKT"
/db_xref="PDB:4QLW"
/db_xref="PDB:4WKX"
/db_xref="PDB:5AZU"
/db_xref="PDB:5I26"
/db_xref="PDB:5I28"
/db_xref="PDB:5SYD"
/db_xref="PDB:5YT7"
/db_xref="PDB:6GYI"
/db_xref="PDB:6IAV"
/db_xref="PDB:6MJR"
/db_xref="PDB:6MJS"
/db_xref="PDB:6MJT"
/db_xref="UniProtKB/Swiss-Prot:P00282"
/protein_id="CAA30279.1"
/translation="MLRKLAAVSLLSLLSAPLLAAECSVDIQGNDQMQFNTNAITVDK
SCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIA
HTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK"
sig_peptide 488..547
/note="signal peptide (AA -19 to -1)"
mat_peptide 548..931
/note="mat. azurin (AA 1 - 128)"
regulatory 961..983
/note="put. transcription terminator"
/regulatory_class="terminator"
BASE COUNT 230 a 422 c 426 g 206 t
ORIGIN
1 ctgcaggctc tgcgggatga tcccgatcac ttcgccgccg cggccaatgc ggcgtccgcc
61 acggtgccca tcagaccgac cgcgccgcca ccgtagacca gggtcaggcc gcgctcggcc
121 aggtgccggc cgagggccac ggcggcttcc tggtagaccg gggaagcgcc ggggctggcg
181 ccacagaata cgcagacgga acgcaaggtc atgatcgact cctgtcgggg gtggaaaaag
241 gcgcacaggg tagcggctgg gagcgcttcg accaagccgt gcgaagcatt gccggacgtt
301 gcgtcgcagg cgcgaagcgg cacatctgtg ctaaaacagg agttccccgt agtaaacgcc
361 gggcagatcc cgctcgatgc cccgccacgt ccggttcggg tttgacctga atcagtggaa
421 ctcggtgccc gatcgggcag tctgctcttt caggattcat cgcccaacct gcctaggagg
481 ctgctccatg ctacgtaaac tcgctgcggt atccctgctg tccctgctca gtgcgccgct
541 gctggctgcc gagtgctcgg tggacatcca gggtaacgac cagatgcagt tcaacaccaa
601 tgccatcacc gtcgacaaga gctgcaagca gttcaccgtc aacctgtccc accccggcaa
661 cctgccgaag aacgtcatgg gccacaactg ggtactgagc accgccgccg acatgcaggg
721 cgtggtcacc gacggcatgg cttccggcct ggacaaggat tacctgaagc ccgacgacag
781 ccgcgtcatc gcccacacca agctgatcgg ctcgggcgag aaggactcgg tgaccttcga
841 cgtctccaag ctgaaggaag gcgagcagta catgttcttc tgcaccttcc cgggccactc
901 cgcgctgatg aagggcaccc tgaccctgaa gtgatgcgcg acgatccgct gcatgaaaaa
961 gcccggccgc tgccgggctt tttcatgggc gcgcgccggg ctcagcgcgt agcgtgccgc
1021 catcgcctcg ccggccagtt ggtgcacgcg ccgggtcgga tgccactcgt cccagaagta
1081 gtactggtcc gggttggcgc aggccgggcg gacgctgggc tgggtcggct ggcagggcgc
1141 gtccagctcc accaggccat agcgcgccgg gttgcgccgc aagtggcggc tgaaggtgag
1201 atggtcgaac cagctcagct ccaggccgcg ggtcttgcgc agggcggcga gctggatcgg
1261 caggctggcg ttgactgcct gcag
//