LOCUS       X03591                   638 bp    DNA     linear   BCT 30-MAR-1995
DEFINITION  Streptomyces avidinii gene for streptavidin.
ACCESSION   X03591
VERSION     X03591.1
KEYWORDS    streptavidin.
SOURCE      Streptomyces avidinii
  ORGANISM  Streptomyces avidinii
            Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae;
            Streptomyces.
REFERENCE   1  (bases 1 to 638)
  AUTHORS   Argarana C.E., Kuntz I.D., Birken S., Axel R., Cantor C.R.
  TITLE     Molecular cloning and nucleotide sequence of the streptavidin gene
  JOURNAL   Nucleic Acids Res. 14(4), 1871-1882(1986).
   PUBMED   3951999
COMMENT     Data kindly reviewed (13-JUL-1986) by C. Argarana
FEATURES             Location/Qualifiers
     source          1..638
                     /organism="Streptomyces avidinii"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:1895"
     CDS             50..601
                     /transl_table=11
                     /note="put. streptavidin precursor"
                     /db_xref="GOA:P22629"
                     /db_xref="InterPro:IPR005468"
                     /db_xref="InterPro:IPR005469"
                     /db_xref="InterPro:IPR017889"
                     /db_xref="InterPro:IPR036896"
                     /db_xref="PDB:1DF8"
                     /db_xref="PDB:1HQQ"
                     /db_xref="PDB:1HXL"
                     /db_xref="PDB:1HXZ"
                     /db_xref="PDB:1HY2"
                     /db_xref="PDB:1I9H"
                     /db_xref="PDB:1KFF"
                     /db_xref="PDB:1KL3"
                     /db_xref="PDB:1KL4"
                     /db_xref="PDB:1KL5"
                     /db_xref="PDB:1LCV"
                     /db_xref="PDB:1LCW"
                     /db_xref="PDB:1LCZ"
                     /db_xref="PDB:1LUQ"
                     /db_xref="PDB:1MEP"
                     /db_xref="PDB:1MK5"
                     /db_xref="PDB:1MM9"
                     /db_xref="PDB:1MOY"
                     /db_xref="PDB:1N43"
                     /db_xref="PDB:1N4J"
                     /db_xref="PDB:1N7Y"
                     /db_xref="PDB:1N9M"
                     /db_xref="PDB:1N9Y"
                     /db_xref="PDB:1NBX"
                     /db_xref="PDB:1NC9"
                     /db_xref="PDB:1NDJ"
                     /db_xref="PDB:1NQM"
                     /db_xref="PDB:1PTS"
                     /db_xref="PDB:1RST"
                     /db_xref="PDB:1RSU"
                     /db_xref="PDB:1RXH"
                     /db_xref="PDB:1RXJ"
                     /db_xref="PDB:1RXK"
                     /db_xref="PDB:1SLD"
                     /db_xref="PDB:1SLE"
                     /db_xref="PDB:1SLF"
                     /db_xref="PDB:1SLG"
                     /db_xref="PDB:1SRE"
                     /db_xref="PDB:1SRF"
                     /db_xref="PDB:1SRG"
                     /db_xref="PDB:1SRH"
                     /db_xref="PDB:1SRI"
                     /db_xref="PDB:1SRJ"
                     /db_xref="PDB:1STP"
                     /db_xref="PDB:1STR"
                     /db_xref="PDB:1STS"
                     /db_xref="PDB:1SWA"
                     /db_xref="PDB:1SWB"
                     /db_xref="PDB:1SWC"
                     /db_xref="PDB:1SWD"
                     /db_xref="PDB:1SWE"
                     /db_xref="PDB:1SWF"
                     /db_xref="PDB:1SWG"
                     /db_xref="PDB:1SWH"
                     /db_xref="PDB:1SWJ"
                     /db_xref="PDB:1SWK"
                     /db_xref="PDB:1SWL"
                     /db_xref="PDB:1SWN"
                     /db_xref="PDB:1SWO"
                     /db_xref="PDB:1SWP"
                     /db_xref="PDB:1SWQ"
                     /db_xref="PDB:1SWR"
                     /db_xref="PDB:1SWS"
                     /db_xref="PDB:1SWT"
                     /db_xref="PDB:1SWU"
                     /db_xref="PDB:1VWA"
                     /db_xref="PDB:1VWB"
                     /db_xref="PDB:1VWC"
                     /db_xref="PDB:1VWD"
                     /db_xref="PDB:1VWE"
                     /db_xref="PDB:1VWF"
                     /db_xref="PDB:1VWG"
                     /db_xref="PDB:1VWH"
                     /db_xref="PDB:1VWI"
                     /db_xref="PDB:1VWJ"
                     /db_xref="PDB:1VWK"
                     /db_xref="PDB:1VWL"
                     /db_xref="PDB:1VWM"
                     /db_xref="PDB:1VWN"
                     /db_xref="PDB:1VWO"
                     /db_xref="PDB:1VWP"
                     /db_xref="PDB:1VWQ"
                     /db_xref="PDB:1VWR"
                     /db_xref="PDB:2BC3"
                     /db_xref="PDB:2F01"
                     /db_xref="PDB:2G5L"
                     /db_xref="PDB:2GH7"
                     /db_xref="PDB:2IZA"
                     /db_xref="PDB:2IZB"
                     /db_xref="PDB:2IZC"
                     /db_xref="PDB:2IZD"
                     /db_xref="PDB:2IZE"
                     /db_xref="PDB:2IZF"
                     /db_xref="PDB:2IZG"
                     /db_xref="PDB:2IZH"
                     /db_xref="PDB:2IZI"
                     /db_xref="PDB:2IZJ"
                     /db_xref="PDB:2IZK"
                     /db_xref="PDB:2IZL"
                     /db_xref="PDB:2QCB"
                     /db_xref="PDB:2RTA"
                     /db_xref="PDB:2RTB"
                     /db_xref="PDB:2RTC"
                     /db_xref="PDB:2RTD"
                     /db_xref="PDB:2RTE"
                     /db_xref="PDB:2RTF"
                     /db_xref="PDB:2RTG"
                     /db_xref="PDB:2RTH"
                     /db_xref="PDB:2RTI"
                     /db_xref="PDB:2RTJ"
                     /db_xref="PDB:2RTK"
                     /db_xref="PDB:2RTL"
                     /db_xref="PDB:2RTM"
                     /db_xref="PDB:2RTN"
                     /db_xref="PDB:2RTO"
                     /db_xref="PDB:2RTP"
                     /db_xref="PDB:2RTQ"
                     /db_xref="PDB:2RTR"
                     /db_xref="PDB:2WPU"
                     /db_xref="PDB:2Y3E"
                     /db_xref="PDB:2Y3F"
                     /db_xref="PDB:3MG5"
                     /db_xref="PDB:3PK2"
                     /db_xref="PDB:3RDM"
                     /db_xref="PDB:3RDO"
                     /db_xref="PDB:3RDQ"
                     /db_xref="PDB:3RDS"
                     /db_xref="PDB:3RDU"
                     /db_xref="PDB:3RDX"
                     /db_xref="PDB:3RE5"
                     /db_xref="PDB:3RE6"
                     /db_xref="PDB:3RY1"
                     /db_xref="PDB:3RY2"
                     /db_xref="PDB:3T6F"
                     /db_xref="PDB:3T6L"
                     /db_xref="PDB:3WYP"
                     /db_xref="PDB:3WYQ"
                     /db_xref="PDB:3WZN"
                     /db_xref="PDB:3WZO"
                     /db_xref="PDB:3WZP"
                     /db_xref="PDB:3WZQ"
                     /db_xref="PDB:3X00"
                     /db_xref="PDB:4BX5"
                     /db_xref="PDB:4BX6"
                     /db_xref="PDB:4BX7"
                     /db_xref="PDB:4CPE"
                     /db_xref="PDB:4CPF"
                     /db_xref="PDB:4CPH"
                     /db_xref="PDB:4CPI"
                     /db_xref="PDB:4DNE"
                     /db_xref="PDB:4EKV"
                     /db_xref="PDB:4GD9"
                     /db_xref="PDB:4GDA"
                     /db_xref="PDB:4GJS"
                     /db_xref="PDB:4GJV"
                     /db_xref="PDB:4IRW"
                     /db_xref="PDB:4JO6"
                     /db_xref="PDB:4OKA"
                     /db_xref="PDB:4Y59"
                     /db_xref="PDB:4Y5D"
                     /db_xref="PDB:4YVB"
                     /db_xref="PDB:5B5F"
                     /db_xref="PDB:5B5G"
                     /db_xref="PDB:5CSE"
                     /db_xref="PDB:5F2B"
                     /db_xref="PDB:5JD2"
                     /db_xref="PDB:5K67"
                     /db_xref="PDB:5K68"
                     /db_xref="PDB:5L3Y"
                     /db_xref="PDB:5N7X"
                     /db_xref="PDB:5N89"
                     /db_xref="PDB:5N8B"
                     /db_xref="PDB:5N8E"
                     /db_xref="PDB:5N8J"
                     /db_xref="PDB:5N8T"
                     /db_xref="PDB:5N8W"
                     /db_xref="PDB:5N99"
                     /db_xref="PDB:5TO2"
                     /db_xref="PDB:5VCQ"
                     /db_xref="PDB:5VKX"
                     /db_xref="PDB:5VL5"
                     /db_xref="PDB:5VL8"
                     /db_xref="PDB:5WBA"
                     /db_xref="PDB:5WBB"
                     /db_xref="PDB:5WBC"
                     /db_xref="PDB:5WBD"
                     /db_xref="PDB:6ANX"
                     /db_xref="PDB:6AUC"
                     /db_xref="PDB:6AUE"
                     /db_xref="PDB:6AUH"
                     /db_xref="PDB:6AUL"
                     /db_xref="PDB:6AUO"
                     /db_xref="PDB:6AVK"
                     /db_xref="PDB:6ESS"
                     /db_xref="PDB:6ESU"
                     /db_xref="PDB:6FH8"
                     /db_xref="PDB:6FRY"
                     /db_xref="PDB:6GH7"
                     /db_xref="PDB:6J6J"
                     /db_xref="PDB:6J6K"
                     /db_xref="PDB:6M9B"
                     /db_xref="UniProtKB/Swiss-Prot:P22629"
                     /protein_id="CAA27265.1"
                     /translation="MRKIVVAAIAVSLTTVSITASASADPSKDSKAQVSAAEAGITGT
                     WYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVA
                     WKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPS
                     AASIDAAKKAGVNNGNPLDAVQQ"
     sig_peptide     50..121
                     /note="put. signal peptide (aa -24 to -1)"
     mat_peptide     122..598
                     /note="mat. streptavidin (aa 1-160)"
BASE COUNT          115 a          244 c          193 g           86 t
ORIGIN      
        1 ccctccgtcc ccgccgggca acaactaggg agtatttttc gtgtctcaca tgcgcaagat
       61 cgtcgttgca gccatcgccg tttccctgac cacggtctcg attacggcca gcgcttcggc
      121 agacccctcc aaggactcga aggcccaggt ctcggccgcc gaggccggca tcaccggcac
      181 ctggtacaac cagctcggct cgaccttcat cgtgaccgcg ggcgccgacg gcgccctgac
      241 cggaacctac gagtcggccg tcggcaacgc cgagagccgc tacgtcctga ccggtcgtta
      301 cgacagcgcc ccggccaccg acggcagcgg caccgccctc ggttggacgg tggcctggaa
      361 gaataactac cgcaacgccc actccgcgac cacgtggagc ggccagtacg tcggcggcgc
      421 cgaggcgagg atcaacaccc agtggctgct gacctccggc accaccgagg ccaacgcctg
      481 gaagtccacg ctggtcggcc acgacacctt caccaaggtg aagccgtccg ccgcctccat
      541 cgacgcggcg aagaaggccg gcgtcaacaa cggcaacccg ctcgacgccg ttcagcagta
      601 gtcgcgtccc ggcaccggcg ggtgccggga cctcggcc
//