ARSA (Search Result) Help

Search Condition

Quick Search

Available Fields

Field	Query Formats
Primary Accession Number	Search all wordsPrimaryAccessionNumber:(AB999999 AND AB999998 ...) Search any wordsPrimaryAccessionNumber:(AB999999 OR AB999999 ...) Regexp queryPrimaryAccessionNumber:/regexp/
Accession Number	Search all wordsAccessionNumber:(AB999999 AND AB888888 ...) Search any wordsAccessionNumber:(AB999999 OR AB888888 ...) Regexp queryAccessionNumber:/regexp/
Division	Search any divisionsDivision:(HUM OR PRI ...)
Sequence Length	Search rangingSequenceLength:[450 TO 500]
Molecular Type	Search any molecular typesMolecularType:(mRNA OR DNA ...)
Molecular Form	Search any molecular formsMolecularForm:(circular OR linear)
Date	Search rangingDate:[20090601 TO 20090701]
Definition	Search all wordsDefinition:(partial AND cds ...) Search any wordsDefinition:(partial OR cds ...) Regexp queryDefinition:/regexp/ Search exactly matchDefinition:"partial cds"
Comment	Search all wordsComment:(sequencing AND project ...) Search any wordsComment:(sequencing OR project ...) Regexp queryComment:/regexp/ Search exactly matchComment:"sequencing project"
Keyword	Search all wordsKeyword:(HTC AND HTC_FLI ...) Search any wordsKeyword:(HTC OR HTC_FLI ...) Regexp queryKeyword:/regexp/ Search exactly matchKeyword:"oligo capping"
Organism	Search all wordsOrganism:(Homo AND sapiens ...) Search any wordsOrganism:(Homo OR sapiens ...) Regexp queryOrganism:/regexp/ Search exactly matchOrganism:"Homo sapiens"
Lineage	Search all wordsLineage:(Eukaryota AND Metazoa ...) Search any wordsLineage:(Eukaryota OR Metazoa ...) Regexp queryLineage:/regexp/
Reference Author	Search all wordsReferenceAuthor:(Mishima AND Shizuoka ...) Search any wordsReferenceAuthor:(Mishima OR Shizuoka ...) Regexp queryReferenceAuthor:/regexp/ Search exactly matchReferenceAuthor:"Mishima,H."
Reference Title	Search all wordsReferenceTitle:(expressed AND liver ...) Search any wordsReferenceTitle:(expressed OR liver ...) Regexp queryReferenceTitle:/regexp/ Search exactly matchReferenceTitle:"expressed in human liver"
Reference Journal	Search all wordsReferenceJournal:(30-NOV-2008 AND Hanako ...) Search any wordsReferenceJournal:(30-NOV-2008 OR Hanako ...) Regexp queryReferenceJournal:/regexp/ Search exactly matchReferenceJournal:"Hanako Mishima"
Reference PubmedID	Search all wordsReferencePubmedID:(1111111 AND 1111112 ...) Search any wordsReferencePubmedID:(1111111 OR 1111112 ...) Regexp queryReferencePubmedID:/regexp/ Search rangingReferencePubmedID:[1111110 TO 1111119]
Feature	Search all wordsFeature:(GT200015 AND gt11 ...) Search any wordsFeature:(GT200015 OR gt11 ...) Search exactly matchFeature:"gene=\"GAPD\""
Feature Qualifier	Search one feature-qualifierFeatureQualifier:/source \/clone=GT200015/ Search all feature-qualifiersFeatureQualifier:(/source \/clone=GT200015/ AND /CDS \/gene=GAPD/ ...)
All Text	Search with field_name 'AllText'AllText:any_formats

LOCUS	AB000000 450 bp mRNA linear HUM 01-JUN-2009
DEFINITION	Homo sapiens GAPD mRNA for glyceraldehyde-3-phosphate dehydrogenase, partial cds.
ACCESSION	AB999999 AB888888 AB777777
VERSION	AB000000.1
KEYWORDS	HTC; HTC_FLI; oligo capping.
SOURCE	Homo sapiens (human)
ORGANISM	Homo sapiens
	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
	Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
	Catarrhini; Hominidae; Homo.
REFERENCE	1 (bases 1 to 450)
AUTHORS	Mishima,H. and Shizuoka,T.
TITLE	Direct Submission
JOURNAL	Submitted (30-NOV-2008) to the DDBJ/EMBL/GenBank databases. Contact:Hanako Mishima National Institute of Genetics, DNA Data Bank of Japan; Yata 1111, Mishima, Shizuoka 411-8540, Japan
PUBMED	1111111
REFERENCE	2
AUTHORS	Mishima,H., Shizuoka,T. and Fuji,I.
TITLE	Glyceraldehyde-3-phosphate dehydrogenase expressed in human liver
JOURNAL	Unpublished (2009)
COMMENT	Human cDNA sequencing project.
FEATURES		Location/Qualifiers
source		1..450
source		/chromosome="12"
source		/clone="GT200015"
source		/clone_lib="lambda gt11 human liver cDNA (GeneTech. No.20)"
source		/db_xref="taxon:9606"
source		/map="12p13"
source		/mol_type="mRNA"
source		/organism="Homo sapiens"
source		/tissue_type="liver"
CDS		86..>450
CDS		/codon_start=1
CDS		/gene="GAPD"
CDS		/product="glyceraldehyde-3-phosphate dehydrogenase"
CDS		/protein_id="BAA12345.1"
CDS		/transl_table=1
CDS		/translation="MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMT YMFKYDTVHGQWKHHEVKVKDSKTLLFGEKEVTVFGCRNPKEIPWGETSAEFVVEYTG VFTDKDKAVAQLKGGAKKV"
BASE COUNT 102 a 119 c 131 g 98 t
ORIGIN
1 cccacgcgtc cggtcgcatc gcacttgtag ctctcgaccc ccgcatctca tccctcctct
61 cgcttagttc agatcgaaat cgcaaatggc gaagattaag atcgggatca atgggttcgg
121 gaggatcggg aggctcgtgg ccagggtggc cctgcagagc gacgacgtcg agctcgtcgc
181 cgtcaacgac cccttcatca ccaccgacta catgacatac atgttcaagt atgacactgt
241 gcacggccag tggaagcatc atgaggttaa ggtgaaggac tccaagaccc ttctcttcgg
301 tgagaaggag gtcaccgtgt tcggctgcag gaaccctaag gagatcccat ggggtgagac
361 tagcgctgag tttgttgtgg agtacactgg tgttttcact gacaaggaca aggccgttgc
421 tcaacttaag ggtggtgcta agaaggtctg
//

Search Result

Facet

List of Entries

1 - entries / Number of founds: 443 FlatFile XML Fasta

	PrimaryAccessionNumber	Definition	SequenceLength	MolecularType	Organism
	MP878994	Sequence 65 from Patent WO2020242380.	72	DNA	synthetic construct
	MQ250826	Sequence 17 from Patent WO2021204998.	29903	DNA	Severe acute respiratory syndrome-related coronavirus
	OQ517298	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021502_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab) gene, partial cds; ORF1a polyprotein (ORF1ab) gene, complete cds; surface glycoprotein (S) gene, partial cds; ORF3a protein (ORF3a), envelope protein (E), membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), and ORF7b (ORF7b) genes, complete cds; ORF8 gene, complete sequence; and nucleocapsid phosphoprotein (N) and ORF10 protein (ORF10) genes, complete cds.	29762	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517299	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021504_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab) gene, partial cds; ORF1a polyprotein (ORF1ab) gene, complete cds; surface glycoprotein (S) gene, partial cds; ORF3a protein (ORF3a) and envelope protein (E) genes, complete cds; membrane glycoprotein (M) gene, partial cds; ORF6 protein (ORF6), ORF7a protein (ORF7a), and ORF7b (ORF7b) genes, complete cds; ORF8 gene, partial sequence; nucleocapsid phosphoprotein (N) gene, partial cds; and ORF10 protein (ORF10) gene, complete cds.	29715	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517300	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021505_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab) gene, partial cds; ORF1a polyprotein (ORF1ab) gene, complete cds; surface glycoprotein (S) gene, partial cds; ORF3a protein (ORF3a) and envelope protein (E) genes, complete cds; membrane glycoprotein (M), ORF6 protein (ORF6), and ORF7a protein (ORF7a) genes, partial cds; ORF7b (ORF7b) gene, complete cds; ORF8 gene, complete sequence; and nucleocapsid phosphoprotein (N) and ORF10 protein (ORF10) genes, complete cds.	29483	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517301	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021506_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab) gene, partial cds; ORF1a polyprotein (ORF1ab) gene, complete cds; surface glycoprotein (S) gene, partial cds; ORF3a protein (ORF3a) gene, complete cds; envelope protein (E) gene, partial cds; and membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), ORF7b (ORF7b), ORF8 protein (ORF8), nucleocapsid phosphoprotein (N), and ORF10 protein (ORF10) genes, complete cds.	29632	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517302	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021507_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab) gene, partial cds; ORF1a polyprotein (ORF1ab) gene, complete cds; surface glycoprotein (S) gene, partial cds; ORF3a protein (ORF3a), envelope protein (E), membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), and ORF7b (ORF7b) genes, complete cds; ORF8 gene, complete sequence; and nucleocapsid phosphoprotein (N) and ORF10 protein (ORF10) genes, complete cds.	29737	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517303	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021508_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab) gene, partial cds; ORF1a polyprotein (ORF1ab) gene, complete cds; surface glycoprotein (S) gene, partial cds; ORF3a protein (ORF3a) gene, complete cds; envelope protein (E) gene, partial cds; membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), and ORF7b (ORF7b) genes, complete cds; ORF8 gene, complete sequence; and nucleocapsid phosphoprotein (N) and ORF10 protein (ORF10) genes, complete cds.	29638	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517304	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021509_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab) gene, partial cds; ORF1a polyprotein (ORF1ab) gene, complete cds; surface glycoprotein (S) gene, partial cds; ORF3a protein (ORF3a), envelope protein (E), membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), and ORF7b (ORF7b) genes, complete cds; ORF8 gene, complete sequence; and nucleocapsid phosphoprotein (N) and ORF10 protein (ORF10) genes, complete cds.	29762	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517305	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021510_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab) gene, partial cds; ORF1a polyprotein (ORF1ab) gene, complete cds; surface glycoprotein (S) gene, partial cds; ORF3a protein (ORF3a), envelope protein (E), membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), and ORF7b (ORF7b) genes, complete cds; ORF8 gene, complete sequence; and nucleocapsid phosphoprotein (N) and ORF10 protein (ORF10) genes, complete cds.	29635	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517306	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021511_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab) gene, partial cds; ORF1a polyprotein (ORF1ab) gene, complete cds; surface glycoprotein (S) gene, partial cds; ORF3a protein (ORF3a) gene, complete cds; envelope protein (E) and membrane glycoprotein (M) genes, partial cds; and ORF6 protein (ORF6), ORF7a protein (ORF7a), ORF7b (ORF7b), ORF8 protein (ORF8), nucleocapsid phosphoprotein (N), and ORF10 protein (ORF10) genes, complete cds.	29604	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517307	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021512_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab) gene, partial cds; ORF1a polyprotein (ORF1ab) gene, complete cds; surface glycoprotein (S) gene, partial cds; ORF3a protein (ORF3a) gene, complete cds; envelope protein (E) gene, partial cds; and membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), ORF7b (ORF7b), ORF8 protein (ORF8), nucleocapsid phosphoprotein (N), and ORF10 protein (ORF10) genes, complete cds.	29635	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517308	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021513_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab) gene, partial cds; ORF1a polyprotein (ORF1ab) gene, complete cds; surface glycoprotein (S) gene, partial cds; ORF3a protein (ORF3a) gene, complete cds; envelope protein (E) and membrane glycoprotein (M) genes, partial cds; ORF6 protein (ORF6), ORF7a protein (ORF7a), and ORF7b (ORF7b) genes, complete cds; ORF8 gene, complete sequence; and nucleocapsid phosphoprotein (N) and ORF10 protein (ORF10) genes, complete cds.	29779	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517309	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021514_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab), ORF1a polyprotein (ORF1ab), surface glycoprotein (S), ORF3a protein (ORF3a), envelope protein (E), membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), and ORF7b (ORF7b) genes, complete cds; ORF8 gene, complete sequence; and nucleocapsid phosphoprotein (N) and ORF10 protein (ORF10) genes, complete cds.	29813	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517310	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021515_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab) gene, partial cds; ORF1a polyprotein (ORF1ab) gene, complete cds; surface glycoprotein (S) gene, partial cds; ORF3a protein (ORF3a), envelope protein (E), membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), and ORF7b (ORF7b) genes, complete cds; ORF8 gene, complete sequence; and nucleocapsid phosphoprotein (N) and ORF10 protein (ORF10) genes, complete cds.	29793	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517311	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021516_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab) gene, partial cds; ORF1a polyprotein (ORF1ab) gene, complete cds; surface glycoprotein (S) gene, partial cds; ORF3a protein (ORF3a) gene, complete cds; envelope protein (E) and membrane glycoprotein (M) genes, partial cds; ORF6 protein (ORF6) gene, complete cds; ORF7a gene, complete sequence; and ORF7b (ORF7b), ORF8 protein (ORF8), nucleocapsid phosphoprotein (N), and ORF10 protein (ORF10) genes, complete cds.	29480	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517312	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021517_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab), ORF1a polyprotein (ORF1ab), surface glycoprotein (S), ORF3a protein (ORF3a), envelope protein (E), membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), and ORF7b (ORF7b) genes, complete cds; ORF8 gene, complete sequence; and nucleocapsid phosphoprotein (N) and ORF10 protein (ORF10) genes, complete cds.	29816	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517313	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021519_2023_NC_045512.2_NC_045512.2/2023, complete genome.	29655	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517314	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021520_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab), ORF1a polyprotein (ORF1ab), surface glycoprotein (S), ORF3a protein (ORF3a), envelope protein (E), membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), and ORF7b (ORF7b) genes, complete cds; ORF8 gene, complete sequence; and nucleocapsid phosphoprotein (N) and ORF10 protein (ORF10) genes, complete cds.	29793	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517315	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021521_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab) gene, partial cds; ORF1a polyprotein (ORF1ab) gene, complete cds; surface glycoprotein (S) gene, partial cds; ORF3a protein (ORF3a) gene, complete cds; envelope protein (E) gene, partial cds; and membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), ORF7b (ORF7b), ORF8 protein (ORF8), nucleocapsid phosphoprotein (N), and ORF10 protein (ORF10) genes, complete cds.	29627	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517316	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021522_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab), ORF1a polyprotein (ORF1ab), surface glycoprotein (S), ORF3a protein (ORF3a), envelope protein (E), membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), and ORF7b (ORF7b) genes, complete cds; ORF8 gene, complete sequence; and nucleocapsid phosphoprotein (N) and ORF10 protein (ORF10) genes, complete cds.	29793	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517317	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021525_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab), ORF1a polyprotein (ORF1ab), surface glycoprotein (S), ORF3a protein (ORF3a), envelope protein (E), membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), and ORF7b (ORF7b) genes, complete cds; ORF8 gene, complete sequence; and nucleocapsid phosphoprotein (N) and ORF10 protein (ORF10) genes, complete cds.	29815	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517318	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021526_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab) gene, partial cds; ORF1a polyprotein (ORF1ab) gene, complete cds; surface glycoprotein (S) gene, partial cds; ORF3a protein (ORF3a), envelope protein (E), membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), and ORF7b (ORF7b) genes, complete cds; ORF8 gene, complete sequence; and nucleocapsid phosphoprotein (N) and ORF10 protein (ORF10) genes, complete cds.	29793	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517319	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021527_2023_NC_045512.2_NC_045512.2/2023, complete genome.	29655	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517320	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021529_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab) gene, partial cds; ORF1a polyprotein (ORF1ab) gene, complete cds; surface glycoprotein (S) gene, partial cds; ORF3a protein (ORF3a), envelope protein (E), membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), and ORF7b (ORF7b) genes, complete cds; ORF8 gene, complete sequence; and nucleocapsid phosphoprotein (N) and ORF10 protein (ORF10) genes, complete cds.	29793	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517321	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021530_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab) gene, partial cds; ORF1a polyprotein (ORF1ab) gene, complete cds; surface glycoprotein (S) gene, partial cds; ORF3a protein (ORF3a), envelope protein (E), membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), and ORF7b (ORF7b) genes, complete cds; ORF8 gene, complete sequence; and nucleocapsid phosphoprotein (N) and ORF10 protein (ORF10) genes, complete cds.	29816	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517322	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021531_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab), ORF1a polyprotein (ORF1ab), surface glycoprotein (S), ORF3a protein (ORF3a), envelope protein (E), membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), and ORF7b (ORF7b) genes, complete cds; ORF8 gene, complete sequence; and nucleocapsid phosphoprotein (N) and ORF10 protein (ORF10) genes, complete cds.	29815	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517323	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021532_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab), ORF1a polyprotein (ORF1ab), surface glycoprotein (S), ORF3a protein (ORF3a), envelope protein (E), membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), and ORF7b (ORF7b) genes, complete cds; ORF8 gene, complete sequence; and nucleocapsid phosphoprotein (N) and ORF10 protein (ORF10) genes, complete cds.	29793	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517324	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021533_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab) gene, partial cds; ORF1a polyprotein (ORF1ab) gene, complete cds; surface glycoprotein (S) gene, partial cds; ORF3a protein (ORF3a), envelope protein (E), membrane glycoprotein (M), ORF6 protein (ORF6), ORF7a protein (ORF7a), and ORF7b (ORF7b) genes, complete cds; ORF8 gene, complete sequence; and nucleocapsid phosphoprotein (N) and ORF10 protein (ORF10) genes, complete cds.	29715	RNA	Severe acute respiratory syndrome coronavirus 2
	OQ517325	Severe acute respiratory syndrome coronavirus 2 isolate SARS-CoV-2/human/USA/USA_UT-IDEL- 2023021534_2023_NC_045512.2_NC_045512.2/2023 ORF1ab polyprotein (ORF1ab) gene, partial cds; ORF1a polyprotein (ORF1ab) gene, complete cds; surface glycoprotein (S) gene, partial cds; ORF3a protein (ORF3a) gene, complete cds; envelope protein (E) and membrane glycoprotein (M) genes, partial cds; ORF6 protein (ORF6), ORF7a protein (ORF7a), and ORF7b (ORF7b) genes, complete cds; ORF8 gene, complete sequence; and nucleocapsid phosphoprotein (N) and ORF10 protein (ORF10) genes, complete cds.	29678	RNA	Severe acute respiratory syndrome coronavirus 2
Now loading