LOCUS PSEHUTR 1604 bp DNA linear BCT 26-APR-1993
DEFINITION P.putida histidine utilization genes repressor protein (hut) gene,
complete cds.
ACCESSION M33922
VERSION M33922.1
KEYWORDS histidine utilization genes repressor protein.
SOURCE Pseudomonas putida
ORGANISM Pseudomonas putida
Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
Pseudomonadaceae; Pseudomonas.
REFERENCE 1 (bases 1 to 1604)
AUTHORS Allison,S.L. and Phillips,A.T.
TITLE Nucleotide sequence of the gene encoding the repressor for the
histidine utilization genes of Pseudomonas putida
JOURNAL J. Bacteriol. 172 (9), 5470-5476 (1990)
PUBMED 2203753
COMMENT Original source text: P.putida (ATCC 12633) DNA.
Draft entry and computer-readable sequence for [J. Bacteriol.
(1990) In press] kindly submitted
by A.T.Phillips, 26-APR-1990.
FEATURES Location/Qualifiers
source 1..1604
/organism="Pseudomonas putida"
/mol_type="genomic DNA"
/db_xref="taxon:303"
misc_feature 82..95
/note="operator site"
regulatory 94..122
/regulatory_class="other"
/note="promoter (put.); putative"
CDS 167..913
/note="histidine utilization genes repressor protein
(hut)"
/codon_start=1
/transl_table=11
/protein_id="AAA25841.1"
/translation="MPTPPVSALVAQMGEGPAPLYARVKQMIIQQIDNGSWPPHHRVP
SESELVNELGFSRMTINRALRELTADGLLVRMQGVGTFVAEPKGRSALFEVNNIADEI
AARGHQHSCQVITLTEEAAGSERALALDMREGQRVFHSLIVHFENGVPVQIEDRYVNA
AIAPDYLKQDFTRQTPYAYLSQVAPLTEGEHVVEAILAEPEECRLLQIERGEPCLLIR
RRTWSGRQPVTAARLIHPGSRHRLEGRFSK"
regulatory 894..898
/regulatory_class="ribosome_binding_site"
/note="ribosomal binding site (put.); putative"
CDS 910..1482
/note="protein of unknown function"
/codon_start=1
/transl_table=11
/protein_id="AAA25842.1"
/translation="MSQLQLLRAQDYPRMPWKNGGGFTEEITRDSGEGLDGFGWRLSI
ADIEESGGFSTFAGYQRIITVLQGDGMRLLVDGQPSRPLLPFDAFAFSGESQVSCKLL
GGAIRDFNLIYAPQRYRARLQWFDGTSRLYSSASTVLLFAASSHVEVSMAGREVQRLG
LYDCLRLEGNDELLGLEVQGRFCLIELISR"
regulatory 1516..1543
/regulatory_class="other"
/note="transcription termination signal"
BASE COUNT 295 a 484 c 513 g 312 t
ORIGIN
1 ggacatggct ggcccagccc gtaggcaaca gagcgcgttc ggcgaagtag gcggacatcg
61 gtcaaatcct gttattgtta acttgtatat acatatacag gcgtttgcct gccgggtaaa
121 ctgcggcaag ctaccgttca ttccctatgc acaaggatcc aacgccgtgc cgacacctcc
181 tgtctccgcg ctggttgccc agatgggcga gggcccggcg ccgctgtatg cccgggtcaa
241 acagatgatc atccagcaga tcgacaacgg cagctggccg ccgcatcacc gggtcccctc
301 ggagagtgaa ctggtcaacg agctaggctt cagccgcatg accatcaacc gtgccctgcg
361 cgaactcacg gccgacggcc tgctggtgcg catgcagggg gtcggcacgt tcgtagccga
421 gccaaagggc cgttcggcgt tgttcgaagt caacaacatt gccgatgaaa ttgccgcgcg
481 cggccatcag catagctgcc aggtgatcac gctcaccgag gaagcagccg gttccgaacg
541 ggccctggcc ctggacatgc gtgaaggcca gcgggtgttc cactcgctga tcgtgcattt
601 cgagaacggc gtgccggtgc agatcgagga ccgctacgtc aacgccgcga tcgcacccga
661 ctacctcaag caggatttca cccggcagac gccatatgcc tacctgtccc aggtagcgcc
721 gctgaccgag ggtgagcacg tggtcgaagc catcctggcc gagccggaag aatgccgcct
781 gctgcagatc gagcggggcg aaccttgcct gctgatccgc cgtcgtactt ggtccggccg
841 ccagccggta accgcggcgc ggctgatcca ccccggttcc cgtcatcgcc tggaaggacg
901 tttcagcaaa tgagccagct gcagttgttg cgcgcacagg attacccgcg catgccgtgg
961 aagaacggtg gcggtttcac cgaagagatc acccgcgaca gtggagaggg cctggacggc
1021 tttggctggc gcctgtcgat tgccgatatc gaagagtctg gcggcttttc caccttcgcc
1081 ggttaccagc ggatcatcac cgtgctgcag ggcgatggca tgcgcctgtt ggtcgatggc
1141 cagcccagcc ggccgttgct gccgttcgat gcctttgcct tcagcggcga aagccaggtc
1201 agctgcaagc tgctgggtgg ggcgatccgc gatttcaacc tgatctatgc accgcaacgg
1261 taccgggcga ggttgcagtg gtttgatggc acgagccgtt tgtacagctc ggcgtcgaca
1321 gtgctgttgt ttgctgccag cagtcacgtg gaagtgtcca tggcggggcg tgaggtgcag
1381 cggttggggt tgtatgactg cctgcggctg gagggcaacg atgagttgct tgggctggaa
1441 gttcaggggc ggttttgctt gattgagctc atttctcgct gatgggcttg gcgatacatt
1501 ttcatcgcct gtgagatcga gcgccgcgcg ggcggcgctc gatttgcgcg ccgccgcaaa
1561 actcaagccg gaccgacgct cgcttcaccc ccccaaaaaa aatc
//