LOCUS PSEHUTR 1604 bp DNA linear BCT 26-APR-1993 DEFINITION P.putida histidine utilization genes repressor protein (hut) gene, complete cds. ACCESSION M33922 VERSION M33922.1 KEYWORDS histidine utilization genes repressor protein. SOURCE Pseudomonas putida ORGANISM Pseudomonas putida Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas. REFERENCE 1 (bases 1 to 1604) AUTHORS Allison,S.L. and Phillips,A.T. TITLE Nucleotide sequence of the gene encoding the repressor for the histidine utilization genes of Pseudomonas putida JOURNAL J. Bacteriol. 172 (9), 5470-5476 (1990) PUBMED 2203753 COMMENT Original source text: P.putida (ATCC 12633) DNA. Draft entry and computer-readable sequence for [J. Bacteriol. (1990) In press] kindly submitted by A.T.Phillips, 26-APR-1990. FEATURES Location/Qualifiers source 1..1604 /organism="Pseudomonas putida" /mol_type="genomic DNA" /db_xref="taxon:303" misc_feature 82..95 /note="operator site" regulatory 94..122 /regulatory_class="other" /note="promoter (put.); putative" CDS 167..913 /note="histidine utilization genes repressor protein (hut)" /codon_start=1 /transl_table=11 /protein_id="AAA25841.1" /translation="MPTPPVSALVAQMGEGPAPLYARVKQMIIQQIDNGSWPPHHRVP SESELVNELGFSRMTINRALRELTADGLLVRMQGVGTFVAEPKGRSALFEVNNIADEI AARGHQHSCQVITLTEEAAGSERALALDMREGQRVFHSLIVHFENGVPVQIEDRYVNA AIAPDYLKQDFTRQTPYAYLSQVAPLTEGEHVVEAILAEPEECRLLQIERGEPCLLIR RRTWSGRQPVTAARLIHPGSRHRLEGRFSK" regulatory 894..898 /regulatory_class="ribosome_binding_site" /note="ribosomal binding site (put.); putative" CDS 910..1482 /note="protein of unknown function" /codon_start=1 /transl_table=11 /protein_id="AAA25842.1" /translation="MSQLQLLRAQDYPRMPWKNGGGFTEEITRDSGEGLDGFGWRLSI ADIEESGGFSTFAGYQRIITVLQGDGMRLLVDGQPSRPLLPFDAFAFSGESQVSCKLL GGAIRDFNLIYAPQRYRARLQWFDGTSRLYSSASTVLLFAASSHVEVSMAGREVQRLG LYDCLRLEGNDELLGLEVQGRFCLIELISR" regulatory 1516..1543 /regulatory_class="other" /note="transcription termination signal" BASE COUNT 295 a 484 c 513 g 312 t ORIGIN 1 ggacatggct ggcccagccc gtaggcaaca gagcgcgttc ggcgaagtag gcggacatcg 61 gtcaaatcct gttattgtta acttgtatat acatatacag gcgtttgcct gccgggtaaa 121 ctgcggcaag ctaccgttca ttccctatgc acaaggatcc aacgccgtgc cgacacctcc 181 tgtctccgcg ctggttgccc agatgggcga gggcccggcg ccgctgtatg cccgggtcaa 241 acagatgatc atccagcaga tcgacaacgg cagctggccg ccgcatcacc gggtcccctc 301 ggagagtgaa ctggtcaacg agctaggctt cagccgcatg accatcaacc gtgccctgcg 361 cgaactcacg gccgacggcc tgctggtgcg catgcagggg gtcggcacgt tcgtagccga 421 gccaaagggc cgttcggcgt tgttcgaagt caacaacatt gccgatgaaa ttgccgcgcg 481 cggccatcag catagctgcc aggtgatcac gctcaccgag gaagcagccg gttccgaacg 541 ggccctggcc ctggacatgc gtgaaggcca gcgggtgttc cactcgctga tcgtgcattt 601 cgagaacggc gtgccggtgc agatcgagga ccgctacgtc aacgccgcga tcgcacccga 661 ctacctcaag caggatttca cccggcagac gccatatgcc tacctgtccc aggtagcgcc 721 gctgaccgag ggtgagcacg tggtcgaagc catcctggcc gagccggaag aatgccgcct 781 gctgcagatc gagcggggcg aaccttgcct gctgatccgc cgtcgtactt ggtccggccg 841 ccagccggta accgcggcgc ggctgatcca ccccggttcc cgtcatcgcc tggaaggacg 901 tttcagcaaa tgagccagct gcagttgttg cgcgcacagg attacccgcg catgccgtgg 961 aagaacggtg gcggtttcac cgaagagatc acccgcgaca gtggagaggg cctggacggc 1021 tttggctggc gcctgtcgat tgccgatatc gaagagtctg gcggcttttc caccttcgcc 1081 ggttaccagc ggatcatcac cgtgctgcag ggcgatggca tgcgcctgtt ggtcgatggc 1141 cagcccagcc ggccgttgct gccgttcgat gcctttgcct tcagcggcga aagccaggtc 1201 agctgcaagc tgctgggtgg ggcgatccgc gatttcaacc tgatctatgc accgcaacgg 1261 taccgggcga ggttgcagtg gtttgatggc acgagccgtt tgtacagctc ggcgtcgaca 1321 gtgctgttgt ttgctgccag cagtcacgtg gaagtgtcca tggcggggcg tgaggtgcag 1381 cggttggggt tgtatgactg cctgcggctg gagggcaacg atgagttgct tgggctggaa 1441 gttcaggggc ggttttgctt gattgagctc atttctcgct gatgggcttg gcgatacatt 1501 ttcatcgcct gtgagatcga gcgccgcgcg ggcggcgctc gatttgcgcg ccgccgcaaa 1561 actcaagccg gaccgacgct cgcttcaccc ccccaaaaaa aatc //