LOCUS AH002633 1843 bp DNA linear HUM 10-JUN-2016
DEFINITION Homo sapiens thymocyte antigen (CD1A) gene, complete cds.
ACCESSION AH002633 J03584 M18229 M22080 M22163 M22164 M22165 M22166 M22167
VERSION AH002633.2
KEYWORDS thymocyte antigen.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1843)
AUTHORS Martin,L.H., Calabi,F., Lefebvre,F.A., Bilsland,C.A. and
Milstein,C.
TITLE Structure and expression of the human thymocyte antigens CD1a,
CD1b, and CD1c
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 84 (24), 9189-9193 (1987)
PUBMED 2447586
COMMENT On or before Jun 10, 2016 this sequence version replaced M22080.1,
M22163.1, M22164.1, M22165.1, M22166.1, M22167.1, AH002633.1.
FEATURES Location/Qualifiers
source 1..1843
/organism="Homo sapiens"
/mol_type="genomic DNA"
/db_xref="taxon:9606"
/map="1q22-q23"
gene 266..1843
/gene="CD1A"
CDS join(266..323,438..704,825..1103,1224..1502,1623..1713,
1834..1843)
/gene="CD1A"
/note="precursor"
/codon_start=1
/product="thymocyte antigen"
/protein_id="AAA51932.1"
/db_xref="GDB:G00-120-575"
/translation="MLFLLLPLLAVLPGDGNADGLKEPLSFHVTWIASFYNHSWKQNL
VSGWLSDLQTHTWDSNSSTIVFLCPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYA
HELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKH
FCKVLNQNQHENDITHNLLSDTCPRFILGLLDAGKAHLQRQVKPEAWLSHGPSPGPGH
LQLVCHVSGFYPKPVWVMWMRGEQEQQGTQRGDILPSADGTWYLRATLEVAAGEAADL
SCRVKHSSLEGQDIVLYWEHHSSVGFIILAVIVPLLLLIGLALWFRKRCFC"
sig_peptide 266..313
/gene="CD1A"
/note="thymocyte antigen CD1a signal peptide"
mat_peptide join(314..323,438..704,825..1103,1224..1502,1623..1713,
1834..1840)
/gene="CD1A"
/product="thymocyte antigen"
/note="G00-120-575"
mat_peptide join(1712..1713,1834..1840)
/gene="CD1A"
/product="thymocyte antigen CD1a"
exon <266..323
/gene="CD1A"
/note="G00-120-575"
/number=1
intron 324..>328
/gene="CD1A"
/note="G00-120-575"
/number=1
gap 329..428
/estimated_length=unknown
intron <429..437
/gene="CD1A"
/note="G00-120-575"
/number=1
exon 438..704
/gene="CD1A"
/note="G00-120-575"
/number=2
intron 705..>714
/gene="CD1A"
/note="G00-120-575"
/number=2
gap 715..814
/estimated_length=unknown
intron <815..824
/gene="CD1A"
/note="G00-120-575"
/number=2
exon 825..1103
/gene="CD1A"
/note="G00-120-575"
/number=3
intron 1104..>1113
/gene="CD1A"
/note="G00-120-575"
/number=3
gap 1114..1213
/estimated_length=unknown
intron <1214..1223
/gene="CD1A"
/note="G00-120-575"
/number=3
exon 1224..1502
/gene="CD1A"
/note="G00-120-575"
/number=4
intron 1503..>1512
/gene="CD1A"
/note="G00-120-575"
/number=4
gap 1513..1612
/estimated_length=unknown
intron <1613..1622
/gene="CD1A"
/note="G00-120-575"
/number=4
exon 1623..1713
/gene="CD1A"
/note="G00-120-575"
/number=5
intron 1714..>1723
/gene="CD1A"
/number=5
gap 1724..1823
/estimated_length=unknown
intron <1824..1833
/gene="CD1A"
/note="G00-120-575"
/number=5
exon 1834..>1843
/gene="CD1A"
/note="G00-120-575"
/number=6
BASE COUNT 330 a 291 c 377 g 345 t
ORIGIN
1 gaattagggg aaggtgaata agttggaggt tggtgacaag gagagaagct ggaacagaga
61 ggagagtcag aaccagaggg aaatgagaga ctgagtaggc atctcagggt ttttgaagga
121 gtggattttc tttgttgcag tcaggggagg tttgtctgtt ggctgcagaa agaagtcaga
181 atagagatat cgtggggtag gtttgtttgg aacagaaatc aaagaccaat ttttctgaga
241 gaaggaaata acatctgcaa atgatatgct gtttttgcta cttccattgt tagctgttct
301 cccaggtgat ggcaatgcag acggtaagnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
361 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
421 nnnnnnnntt gtcgcagggc tcaaggagcc tctctccttc catgtcacct ggatcgcatc
481 cttttacaac cattcctgga aacaaaatct ggtctcaggt tggctgagtg atttgcagac
541 tcatacctgg gacagcaatt ccagcaccat cgttttcctg tgcccctggt ccaggggaaa
601 cttcagcaat gaggagtgga aggaactgga aacattattc cgtatacgca ccattcggtc
661 atttgaggga attcgtagat acgcccatga attgcagttt gaatgtgagt tcagnnnnnn
721 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
781 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnataacc ccagatcctt ttgagataca
841 ggtgacagga ggctgtgagc tgcactctgg aaaggtctca ggaagcttct tgcagttagc
901 ttatcaagga tcagactttg tgagcttcca gaacaattca tggttgccat atccagtggc
961 tgggaatatg gccaagcatt tctgcaaagt gctcaatcag aatcagcatg aaaatgacat
1021 aacacacaat cttctcagtg acacctgccc acgtttcatc ttgggtcttc ttgatgcagg
1081 aaaggcacat ctccagcggc aaggtcagtc ctgnnnnnnn nnnnnnnnnn nnnnnnnnnn
1141 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
1201 nnnnnnnnnn nnntcctttg cagtgaagcc cgaggcctgg ctgtcccatg gccccagtcc
1261 tggccctggc catctgcagc ttgtgtgcca tgtctcagga ttctacccaa agcccgtgtg
1321 ggtgatgtgg atgcggggtg agcaggagca gcagggcact cagcgagggg acatcttgcc
1381 cagtgctgat gggacatggt atctccgcgc aaccctggag gtggccgctg gggaggcagc
1441 tgacctgtcc tgtcgggtga agcacagcag tctagagggc caggacatcg tcctctactg
1501 gggtgagaaa aannnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
1561 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnaaattcac
1621 agagcatcac agttccgtgg gcttcatcat cttggcggtg atagtgcctt tacttcttct
1681 gataggtctt gcgctttggt tcaggaaacg ctggtgagtt cttnnnnnnn nnnnnnnnnn
1741 nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn
1801 nnnnnnnnnn nnnnnnnnnn nnntctcatc cagtttctgt taa
//