LOCUS M14604 504 bp DNA linear BCT 22-JUN-1999 DEFINITION Pseudomonas fragi lipase precursor, gene, complete cds. ACCESSION M14604 VERSION M14604.1 KEYWORDS lipase. SOURCE Pseudomonas fragi ORGANISM Pseudomonas fragi Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas. REFERENCE 1 (bases 1 to 504) AUTHORS Kugimiya,W., Otani,Y., Hashimoto,Y. and Takagi,Y. TITLE Molecular cloning and nucleotide sequence of the lipase gene from Pseudomonas fragi JOURNAL Biochem. Biophys. Res. Commun. 141 (1), 185-190 (1986) PUBMED 3800995 COMMENT Draft entry and printed copy of sequence [1] kindly provided by W.Kugimiya, 02-MAR-1987. FEATURES Location/Qualifiers source 1..504 /organism="Pseudomonas fragi" /mol_type="genomic DNA" /strain="IFO 3458" /type_material="type strain of Pseudomonas fragi" /db_xref="taxon:296" /clone="pKKO" CDS 49..456 /EC_number="3.1.1.3" /codon_start=1 /transl_table=11 /product="lipase precursor" /protein_id="AAA25879.1" /translation="MDDSVNTRYPILLVHGLFGFDRIGSHHYFHGIKQALNECGASVF VPIISAANDNEARGDQLLKQIHNLRRQVGAQRVNLIGHSQGALTARYVAAIAPELIAS VTSVSGPNHGSELADRCAWPLSRGGLAKRWLPP" sig_peptide 49..102 mat_peptide 103..453 /product="lipase" BASE COUNT 104 a 162 c 135 g 103 t ORIGIN 1 aagcttggct gcaggtcgac ggatcaaaaa caccctgcga gattgaacat ggacgattcg 61 gtaaatacac gctatccgat cttattggta cacggccttt ttggattcga ccggataggc 121 tcgcatcact actttcatgg tatcaagcaa gcactcaatg agtgcggtgc cagcgtcttc 181 gttccaatca tttcagccgc caacgacaat gaagcccgag gcgatcaact gctcaagcag 241 atccacaacc tgcgcaggca ggtcggtgca cagcgtgtca acctgatcgg ccacagccag 301 ggcgccctta ccgcgcgtta tgtggcggcc atcgcccctg aactgatcgc ctcggtgacg 361 tcagtcagtg gccccaacca cggctccgag ctggccgatc gttgcgcctg gcctttgtcc 421 cggggaggct tggcgaaacg gtggctgccg ccctgaccac ctcgttcagc gcatttttat 481 ccgccctcag ggccacaccc gcgc //