LOCUS SYN9KIL 138 bp DNA linear SYN 27-APR-1993 DEFINITION Plasmid pMB9 kil gene. ACCESSION M13468 VERSION M13468.1 KEYWORDS . SOURCE unidentified cloning vector ORGANISM unidentified cloning vector other sequences; artificial sequences; vectors. REFERENCE 1 (bases 1 to 138) AUTHORS Kobayashi,T., Kato,C., Kudo,T. and Horikoshi,K. TITLE Excretion of the penicillinase of an alkalophilic Bacillus sp. through the Escherichia coli outer membrane is caused by insertional activation of the kil gene in plasmid pMB9 JOURNAL J. Bacteriol. 166 (3), 728-732 (1986) PUBMED 3011739 COMMENT Original source text: Plasmid pMB9 DNA. FEATURES Location/Qualifiers source 1..138 /organism="unidentified cloning vector" /mol_type="genomic DNA" /db_xref="taxon:45196" CDS 1..138 /note="kil gene peptide" /codon_start=1 /transl_table=11 /protein_id="AAA72539.1" /translation="MRKRFFVGIFAINLLVGCQANYIRDVQGGTIAPSSSSKLTGIAV Q" BASE COUNT 35 a 28 c 36 g 39 t ORIGIN 1 atgaggaaaa gattttttgt gggaatattc gcgataaacc tccttgttgg atgtcaggct 61 aactatatac gtgatgttca gggagggacc atcgcaccat cctcctcttc taaactgacg 121 gggatcgcgg ttcagtag //