LOCUS MUSB72 748 bp mRNA linear ROD 16-FEB-2008 DEFINITION Mus musculus MB7-2 mRNA for a new form of the murine B7, complete cds. ACCESSION D16220 VERSION D16220.1 KEYWORDS T cell activating capacity; immunoglobulin superfamily; transmembrane protein. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 748) AUTHORS Uede,T. TITLE Direct Submission JOURNAL Submitted (10-MAY-1993) to the DDBJ/EMBL/GenBank databases. Contact:Toshimitsu Uede Institute of Immunological Science, Hokkaido University, Section of Immunopathogenesis; Kita-15, Nishi-7, Kita-ku, Sapporo 060, Japan REFERENCE 2 AUTHORS Uede,T. TITLE Mouse MB7-2 mRNA for a new form of the murine B7, complete cds. JOURNAL Unpublished (1994) REFERENCE 3 AUTHORS Inobe,M., Linsley,P.S., Ledbetter,J.A., Nagai,Y., Tamakoshi,M. and Uede,T. TITLE Identification of an alternatively spliced form of the murine homologue of B7 JOURNAL Biochem. Biophys. Res. Commun. 200, 443-449 (1994) COMMENT FEATURES Location/Qualifiers source 1..748 /db_xref="taxon:10090" /mol_type="mRNA" /note="Common name: Mouse" /organism="Mus musculus" /strain="C57BL/6 CrSlc" /tissue_type="spleen" CDS 64..702 /codon_start=1 /gene="B7" /note="alternative spliced form (exon 3 has been spliced out)" /product="MB7-2" /protein_id="BAA03748.1" /translation="MACNCQLMQDTPLLKFPCPRLILLFVLLIRLSQVSSDVDEQLSK SVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTY SLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKAPEDPPDSKNTLVLFGAG FGAVITVVVIVVIIKCFCKHRSCFRRNEASRETNNSLTFGPEEALAEQTVFL" sig_peptide 64..174 mat_peptide 175..699 /gene="B7" /product="MB7-2" BASE COUNT 203 a 175 c 166 g 204 t ORIGIN 1 ctaagcttca ttggctctag attcctggct ttccccatca tgttctccaa agcatctgaa 61 gctatggctt gcaattgtca gttgatgcag gatacaccac tcctcaagtt tccatgtcca 121 aggctcattc ttctctttgt gctgctgatt cgtctttcac aagtgtcttc agatgttgat 181 gaacaactgt ccaagtcagt gaaagataag gtattgctgc cttgccgtta caactctcct 241 catgaagatg agtctgaaga ccgaatctac tggcaaaaac atgacaaagt ggtgctgtct 301 gtcattgctg ggaaactaaa agtgtggccc gagtataaga accggacttt atatgacaac 361 actacctact ctcttatcat cctgggcctg gtcctttcag accggggcac atacagctgt 421 gtcgttcaaa agaaggaaag aggaacgtat gaagttaaac acttggcttt agtaaagttg 481 tccatcaaag ccccagaaga ccctcctgat agcaagaaca cacttgtgct ctttggggca 541 ggattcggcg cagtaataac agtcgtcgtc atcgttgtca tcatcaaatg cttctgtaag 601 cacagaagct gtttcagaag aaatgaggcg agcagagaaa caaacaacag ccttaccttc 661 gggcctgaag aagcattagc tgaacagacc gtcttccttt agttcttctc tgcccatgtg 721 ggatacatgg tattatgtgg ctcgagag //