LOCUS       CT010358                 687 bp    mRNA    linear   ROD 24-SEP-2008
DEFINITION  Mus musculus full open reading frame cDNA clone RZPDo836A0553D for
            gene Cd79b, CD79B antigen; complete cds, incl. stopcodon.
ACCESSION   CT010358
VERSION     CT010358.1
KEYWORDS    Full ORF clone, Expression Shuttle System, Gateway(R), complete
            cds.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 687)
  AUTHORS   Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E.,
            Mollenhauer J., Wiemann S., Schick M., Korn B.
  TITLE     Cloning of mouse full open reading frames in Gateway(R) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 687)
  AUTHORS   Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E.,
            Mollenhauer J., Wiemann S., Schick M., Korn B.
  JOURNAL   Submitted (20-JUL-2005) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            515, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo836A0553D, ORFNo 30460
            http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo836A0553D
            Mouse Full ORF Gateway(R) Clones - RZPD (kan-resist.)
            RZPDLIB No. 836
            http://www.rzpd.de/cgi-bin/products/showLib.pl.cgi/
            response?libNo=836
            http://www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            http://www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is part of a collection of mouse full ORF clones
            jointly established and verified by DKFZ (www.dkfz.de) and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site:
            GACCCAGCTTTCTTGTAC..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_008339 (GI:6680374)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..687
                     /organism="Mus musculus"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Mouse Full ORF Gateway(R) Clones - RZPD"
                     /clone="RZPDo836A0553D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:10090"
     CDS             1..687
                     /codon_start=1
                     /gene="Cd79b"
                     /db_xref="GOA:P15530"
                     /db_xref="InterPro:IPR003110"
                     /db_xref="InterPro:IPR003599"
                     /db_xref="InterPro:IPR007110"
                     /db_xref="InterPro:IPR013098"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR036179"
                     /db_xref="InterPro:IPR039695"
                     /db_xref="MGI:MGI:96431"
                     /db_xref="PDB:3KHO"
                     /db_xref="PDB:3KHQ"
                     /db_xref="UniProtKB/Swiss-Prot:P15530"
                     /protein_id="CAJ18566.1"
                     /translation="MATLVLSSMPCHWLLFLLLLFSGEPVPAMTSSDLPLNFQGSPCS
                     QIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSV
                     YTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKDGI
                     ILIQTLLIILFIIVPIFLLLDKDDGKAGMEEDHTYEGLNIDQTATYEDIVTLRTGEVK
                     WSVGEHPGQE"
BASE COUNT          180 a          187 c          175 g          145 t
ORIGIN      
        1 atggccacac tggtgctgtc ttccatgccc tgccactggc tgttgttcct gctgctgctc
       61 ttctcaggtg agccggtacc agcaatgaca agcagtgacc tgccactgaa tttccaagga
      121 agcccttgtt cccagatctg gcagcacccg aggtttgcag ccaaaaagcg gagctccatg
      181 gtgaagtttc actgctacac aaaccactca ggtgcactga cctggttccg aaagcgaggg
      241 agccagcagc cccaggaact ggtctcagaa gagggacgca ttgtgcagac ccagaatggc
      301 tctgtctaca ccctcactat ccaaaacatc cagtacgagg ataatggtat ctacttctgc
      361 aagcagaaat gtgacagcgc caaccataat gtcaccgaca gctgtggcac ggaacttcta
      421 gtcttaggat tcagcacgtt ggaccaactg aagcggcgga acacactgaa agatggcatt
      481 atcttgatcc agaccctcct catcatcctc ttcatcattg tgcccatctt cctgctactt
      541 gacaaggatg acggcaaggc tgggatggag gaagatcaca cctatgaggg cttgaacatt
      601 gaccagacag ccacctatga agacatagtg actcttcgga caggggaggt aaagtggtcg
      661 gtaggagagc atccaggcca ggaatag
//