LOCUS CT010358 687 bp mRNA linear ROD 24-SEP-2008 DEFINITION Mus musculus full open reading frame cDNA clone RZPDo836A0553D for gene Cd79b, CD79B antigen; complete cds, incl. stopcodon. ACCESSION CT010358 VERSION CT010358.1 KEYWORDS Full ORF clone, Expression Shuttle System, Gateway(R), complete cds. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 687) AUTHORS Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J., Wiemann S., Schick M., Korn B. TITLE Cloning of mouse full open reading frames in Gateway(R) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 687) AUTHORS Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J., Wiemann S., Schick M., Korn B. JOURNAL Submitted (20-JUL-2005) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 515, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo836A0553D, ORFNo 30460 http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo836A0553D Mouse Full ORF Gateway(R) Clones - RZPD (kan-resist.) RZPDLIB No. 836 http://www.rzpd.de/cgi-bin/products/showLib.pl.cgi/ response?libNo=836 http://www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 http://www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is part of a collection of mouse full ORF clones jointly established and verified by DKFZ (www.dkfz.de) and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: GACCCAGCTTTCTTGTAC..att The clone is validated by full sequence check. Compared to the reference sequence NM_008339 (GI:6680374) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..687 /organism="Mus musculus" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Mouse Full ORF Gateway(R) Clones - RZPD" /clone="RZPDo836A0553D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:10090" CDS 1..687 /codon_start=1 /gene="Cd79b" /db_xref="GOA:P15530" /db_xref="InterPro:IPR003110" /db_xref="InterPro:IPR003599" /db_xref="InterPro:IPR007110" /db_xref="InterPro:IPR013098" /db_xref="InterPro:IPR013783" /db_xref="InterPro:IPR036179" /db_xref="InterPro:IPR039695" /db_xref="MGI:MGI:96431" /db_xref="PDB:3KHO" /db_xref="PDB:3KHQ" /db_xref="UniProtKB/Swiss-Prot:P15530" /protein_id="CAJ18566.1" /translation="MATLVLSSMPCHWLLFLLLLFSGEPVPAMTSSDLPLNFQGSPCS QIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSV YTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKDGI ILIQTLLIILFIIVPIFLLLDKDDGKAGMEEDHTYEGLNIDQTATYEDIVTLRTGEVK WSVGEHPGQE" BASE COUNT 180 a 187 c 175 g 145 t ORIGIN 1 atggccacac tggtgctgtc ttccatgccc tgccactggc tgttgttcct gctgctgctc 61 ttctcaggtg agccggtacc agcaatgaca agcagtgacc tgccactgaa tttccaagga 121 agcccttgtt cccagatctg gcagcacccg aggtttgcag ccaaaaagcg gagctccatg 181 gtgaagtttc actgctacac aaaccactca ggtgcactga cctggttccg aaagcgaggg 241 agccagcagc cccaggaact ggtctcagaa gagggacgca ttgtgcagac ccagaatggc 301 tctgtctaca ccctcactat ccaaaacatc cagtacgagg ataatggtat ctacttctgc 361 aagcagaaat gtgacagcgc caaccataat gtcaccgaca gctgtggcac ggaacttcta 421 gtcttaggat tcagcacgtt ggaccaactg aagcggcgga acacactgaa agatggcatt 481 atcttgatcc agaccctcct catcatcctc ttcatcattg tgcccatctt cctgctactt 541 gacaaggatg acggcaaggc tgggatggag gaagatcaca cctatgaggg cttgaacatt 601 gaccagacag ccacctatga agacatagtg actcttcgga caggggaggt aaagtggtcg 661 gtaggagagc atccaggcca ggaatag //