LOCUS BT020104 690 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens ubiquitin B mRNA, complete cds. ACCESSION BT020104 VERSION BT020104.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 690) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 690) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..690 /db_xref="H-InvDB:HIT000266816" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01579X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..690 /codon_start=1 /product="ubiquitin B" /protein_id="AAV38907.1" /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENV KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL TGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST LHLVLRLRGGC" BASE COUNT 186 a 196 c 184 g 124 t ORIGIN 1 atgcagatct tcgtgaaaac ccttaccggc aagaccatca cccttgaggt ggagcccagt 61 gacaccatcg aaaatgtgaa ggccaagatc caggataagg aaggcattcc ccccgaccag 121 cagaggctca tctttgcagg caagcagctg gaagatggcc gtactctttc tgactacaac 181 atccagaagg agtcgaccct gcacctggtc ctgcgtctga gaggtggtat gcagatcttc 241 gtgaagaccc tgaccggcaa gaccatcacc ctggaagtgg agcccagtga caccatcgaa 301 aatgtgaagg ccaagatcca ggataaagaa ggcatccctc ccgaccagca gaggctcatc 361 tttgcaggca agcagctgga agatggccgc actctttctg actacaacat ccagaaggag 421 tcgaccctgc acctggtcct gcgtctgaga ggtggtatgc agatcttcgt gaagaccctg 481 accggcaaga ccatcactct ggaggtggag cccagtgaca ccatcgaaaa tgtgaaggcc 541 aagatccaag ataaagaagg catccccccc gaccagcaga ggctcatctt tgcaggcaag 601 cagctggaag atggccgcac tctttctgac tacaacatcc agaaagagtc gaccctgcac 661 ctggtcctgc gcctgagggg tggctgttag //