LOCUS BT019734 570 bp mRNA linear HUM 28-OCT-2004 DEFINITION Homo sapiens neuroblastoma RAS viral (v-ras) oncogene homolog mRNA, complete cds. ACCESSION BT019734 VERSION BT019734.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 570) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 570) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..570 /db_xref="H-InvDB:HIT000266631" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01295X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..570 /codon_start=1 /product="neuroblastoma RAS viral (v-ras) oncogene homolog" /protein_id="AAV38539.1" /translation="MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQV VIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKR VKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLV REIRQYRMKKLNSSDDGTQGCMGLPCVVM" BASE COUNT 184 a 103 c 151 g 132 t ORIGIN 1 atgactgagt acaaactggt ggtggttgga gcaggtggtg ttgggaaaag cgcactgaca 61 atccagctaa tccagaacca ctttgtagat gaatatgatc ccaccataga ggattcttac 121 agaaaacaag tggttataga tggtgaaacc tgtttgttgg acatactgga tacagctgga 181 caagaagagt acagtgccat gagagaccaa tacatgagga caggcgaagg cttcctctgt 241 gtatttgcca tcaataatag caagtcattt gcggatatta acctctacag ggagcagatt 301 aagcgagtaa aagactcgga tgatgtacct atggtgctag tgggaaacaa gtgtgatttg 361 ccaacaagga cagttgatac aaaacaagcc cacgaactgg ccaagagtta cgggattcca 421 ttcattgaaa cctcagccaa gaccagacag ggtgttgaag atgcttttta cacactggta 481 agagaaatac gccagtaccg aatgaaaaaa ctcaacagca gtgatgatgg gactcagggt 541 tgtatgggat tgccatgtgt ggtgatgtag //