LOCUS       BT019734                 570 bp    mRNA    linear   HUM 28-OCT-2004
DEFINITION  Homo sapiens neuroblastoma RAS viral (v-ras) oncogene homolog mRNA,
            complete cds.
ACCESSION   BT019734
VERSION     BT019734.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 570)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 570)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2004) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..570
                     /db_xref="H-InvDB:HIT000266631"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01295X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..570
                     /codon_start=1
                     /product="neuroblastoma RAS viral (v-ras) oncogene
                     homolog"
                     /protein_id="AAV38539.1"
                     /translation="MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQV
                     VIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKR
                     VKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLV
                     REIRQYRMKKLNSSDDGTQGCMGLPCVVM"
BASE COUNT          184 a          103 c          151 g          132 t
ORIGIN      
        1 atgactgagt acaaactggt ggtggttgga gcaggtggtg ttgggaaaag cgcactgaca
       61 atccagctaa tccagaacca ctttgtagat gaatatgatc ccaccataga ggattcttac
      121 agaaaacaag tggttataga tggtgaaacc tgtttgttgg acatactgga tacagctgga
      181 caagaagagt acagtgccat gagagaccaa tacatgagga caggcgaagg cttcctctgt
      241 gtatttgcca tcaataatag caagtcattt gcggatatta acctctacag ggagcagatt
      301 aagcgagtaa aagactcgga tgatgtacct atggtgctag tgggaaacaa gtgtgatttg
      361 ccaacaagga cagttgatac aaaacaagcc cacgaactgg ccaagagtta cgggattcca
      421 ttcattgaaa cctcagccaa gaccagacag ggtgttgaag atgcttttta cacactggta
      481 agagaaatac gccagtaccg aatgaaaaaa ctcaacagca gtgatgatgg gactcagggt
      541 tgtatgggat tgccatgtgt ggtgatgtag
//