LOCUS BC030210 443 bp mRNA linear HUM 06-JUN-2006 DEFINITION Homo sapiens CD79b molecule, immunoglobulin-associated beta, mRNA (cDNA clone IMAGE:5209928), complete cds. ACCESSION BC030210 VERSION BC030210.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 443) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 443) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (07-MAY-2002) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Life Technologies, Inc. cDNA Library Preparation: Life Technologies, Inc. cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: National Institutes of Health Intramural Sequencing Center (NISC), Gaithersburg, Maryland; Web site: http://www.nisc.nih.gov/ Contact: nisc_mgc@nhgri.nih.gov Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B., Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S., Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P., Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R., Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C., McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W., Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L., Young,A., Zhang,L.-H. and Green,E.D. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAK Plate: 49 Row: j Column: 21 This clone was selected for full length sequencing because it passed the following selection criteria: matched mRNA gi: 11038673 This clone has the following problem: The cds is short compared to the longest cds in the locus. FEATURES Location/Qualifiers source 1..443 /db_xref="H-InvDB:HIT000040981" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="IMAGE:5209928" /tissue_type="Lung, Spleen, fetal, pooled" /clone_lib="NIH_MGC_122" /lab_host="DH10B" /note="Vector: pCMV-SPORT6" gene 1..443 /gene="CD79B" /gene_synonym="B29" /db_xref="GeneID:974" /db_xref="HGNC:HGNC:1699" /db_xref="MIM:147245" CDS 63..302 /gene="CD79B" /gene_synonym="B29" /codon_start=1 /product="CD79B protein" /protein_id="AAH30210.1" /db_xref="GeneID:974" /db_xref="HGNC:HGNC:1699" /db_xref="MIM:147245" /translation="MARLALSPVPSHWMVALLLLLSGTEPTTRPVGFALISSCLGPAA LPPACSTLLLCLSLFTACLPLMALGPGSVGVSCTW" BASE COUNT 68 a 135 c 140 g 100 t ORIGIN 1 gttttcctcc aaggagcctc ggacgttgtc acgggtttgg ggtcggggac agagcggtga 61 ccatggccag gctggcgttg tctcctgtgc ccagccactg gatggtggcg ttgctgctgc 121 tgctctcagg tacagaaccc acgacgaggc ctgtggggtt tgctctcatc tccagctgtc 181 tgggccctgc ggctctgcct cctgcttgct ccaccctcct cctctgtctc tcactcttta 241 ccgcctgtct ccctctcatg gccctggggc ctgggtctgt gggtgtcagc tgcacgtggt 301 gatgggctca ggagcctgtg gccccagttc ctctcctgcc tggagagcat caggctgagc 361 tgggcatgag gagcaaacca gagttagcaa ccaggaccgt ggaagaacta ggctcaggag 421 gaagagaggc tgacacccac aga //