LOCUS       BC030210                 443 bp    mRNA    linear   HUM 06-JUN-2006
DEFINITION  Homo sapiens CD79b molecule, immunoglobulin-associated beta, mRNA
            (cDNA clone IMAGE:5209928), complete cds.
ACCESSION   BC030210
VERSION     BC030210.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 443)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 443)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (07-MAY-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Life Technologies, Inc.
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 49 Row: j Column: 21
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 11038673
            This clone has the following problem: The cds is short compared to
            the longest cds in the locus.
FEATURES             Location/Qualifiers
     source          1..443
                     /db_xref="H-InvDB:HIT000040981"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:5209928"
                     /tissue_type="Lung, Spleen, fetal, pooled"
                     /clone_lib="NIH_MGC_122"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..443
                     /gene="CD79B"
                     /gene_synonym="B29"
                     /db_xref="GeneID:974"
                     /db_xref="HGNC:HGNC:1699"
                     /db_xref="MIM:147245"
     CDS             63..302
                     /gene="CD79B"
                     /gene_synonym="B29"
                     /codon_start=1
                     /product="CD79B protein"
                     /protein_id="AAH30210.1"
                     /db_xref="GeneID:974"
                     /db_xref="HGNC:HGNC:1699"
                     /db_xref="MIM:147245"
                     /translation="MARLALSPVPSHWMVALLLLLSGTEPTTRPVGFALISSCLGPAA
                     LPPACSTLLLCLSLFTACLPLMALGPGSVGVSCTW"
BASE COUNT           68 a          135 c          140 g          100 t
ORIGIN      
        1 gttttcctcc aaggagcctc ggacgttgtc acgggtttgg ggtcggggac agagcggtga
       61 ccatggccag gctggcgttg tctcctgtgc ccagccactg gatggtggcg ttgctgctgc
      121 tgctctcagg tacagaaccc acgacgaggc ctgtggggtt tgctctcatc tccagctgtc
      181 tgggccctgc ggctctgcct cctgcttgct ccaccctcct cctctgtctc tcactcttta
      241 ccgcctgtct ccctctcatg gccctggggc ctgggtctgt gggtgtcagc tgcacgtggt
      301 gatgggctca ggagcctgtg gccccagttc ctctcctgcc tggagagcat caggctgagc
      361 tgggcatgag gagcaaacca gagttagcaa ccaggaccgt ggaagaacta ggctcaggag
      421 gaagagaggc tgacacccac aga
//