LOCUS       AY457036                 251 bp    DNA     linear   BCT 26-JUL-2016
DEFINITION  Pseudomonas syringae strain ATCC 19310 type III secretion system
            protein (hrcN) gene, partial cds.
ACCESSION   AY457036
VERSION     AY457036.1
KEYWORDS    .
SOURCE      Pseudomonas syringae
  ORGANISM  Pseudomonas syringae
            Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
            Pseudomonadaceae; Pseudomonas.
REFERENCE   1  (bases 1 to 251)
  AUTHORS   Rezzonico,F., Defago,G. and Moenne-Loccoz,Y.
  CONSRTM   ETH Zuerich
  TITLE     Comparison of ATPase-encoding type III secretion system hrcN genes
            in biocontrol fluorescent Pseudomonads and in phytopathogenic
            proteobacteria
  JOURNAL   Appl. Environ. Microbiol. 70 (9), 5119-5131 (2004)
   PUBMED   15345390
REFERENCE   2  (bases 1 to 251)
  AUTHORS   Rezzonico,F., Moenne-Loccoz,Y. and Defago,G.
  CONSRTM   ETH Zuerich
  TITLE     Direct Submission
  JOURNAL   Submitted (04-NOV-2003) Plant Pathology, Eth Zuerich,
            Universitaetstr. 2, Zuerich 8092, Switzerland
FEATURES             Location/Qualifiers
     source          1..251
                     /organism="Pseudomonas syringae"
                     /mol_type="genomic DNA"
                     /strain="ATCC 19310"
                     /type_material="type strain of Pseudomonas syringae"
                     /db_xref="ATCC:19310"
                     /db_xref="taxon:317"
     gene            <1..>251
                     /gene="hrcN"
     CDS             <1..>251
                     /gene="hrcN"
                     /note="contains ATPase domain; probable inner membrane
                     component of type III protein secretion system"
                     /codon_start=3
                     /transl_table=11
                     /product="type III secretion system protein"
                     /protein_id="AAR21351.1"
                     /translation="EQDSMNDPVADEVRSLLDGHIVLSRKLAERGHYPAIDVSASISR
                     ILSNVTGREHQRANNRLRQLLAAYKQVEMLLRLGEYQTG"
BASE COUNT           57 a           77 c           75 g           42 t
ORIGIN      
        1 tcgagcagga ttcgatgaac gatccggtcg ccgacgaagt gcgctcgctg ctcgacgggc
       61 acatcgtact gtcgcgcaaa ctggccgagc gcgggcacta cccggcgatc gatgtgtcgg
      121 ccagcatcag ccggattctg agcaacgtca ccggtcgcga acatcaacgg gcgaacaatc
      181 gcctgcgcca gttactggct gcctataaac aagtggaaat gctcctgcgc ctgggtgaat
      241 accaaaccgg a
//