LOCUS AY457036 251 bp DNA linear BCT 26-JUL-2016 DEFINITION Pseudomonas syringae strain ATCC 19310 type III secretion system protein (hrcN) gene, partial cds. ACCESSION AY457036 VERSION AY457036.1 KEYWORDS . SOURCE Pseudomonas syringae ORGANISM Pseudomonas syringae Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas. REFERENCE 1 (bases 1 to 251) AUTHORS Rezzonico,F., Defago,G. and Moenne-Loccoz,Y. CONSRTM ETH Zuerich TITLE Comparison of ATPase-encoding type III secretion system hrcN genes in biocontrol fluorescent Pseudomonads and in phytopathogenic proteobacteria JOURNAL Appl. Environ. Microbiol. 70 (9), 5119-5131 (2004) PUBMED 15345390 REFERENCE 2 (bases 1 to 251) AUTHORS Rezzonico,F., Moenne-Loccoz,Y. and Defago,G. CONSRTM ETH Zuerich TITLE Direct Submission JOURNAL Submitted (04-NOV-2003) Plant Pathology, Eth Zuerich, Universitaetstr. 2, Zuerich 8092, Switzerland FEATURES Location/Qualifiers source 1..251 /organism="Pseudomonas syringae" /mol_type="genomic DNA" /strain="ATCC 19310" /type_material="type strain of Pseudomonas syringae" /db_xref="ATCC:19310" /db_xref="taxon:317" gene <1..>251 /gene="hrcN" CDS <1..>251 /gene="hrcN" /note="contains ATPase domain; probable inner membrane component of type III protein secretion system" /codon_start=3 /transl_table=11 /product="type III secretion system protein" /protein_id="AAR21351.1" /translation="EQDSMNDPVADEVRSLLDGHIVLSRKLAERGHYPAIDVSASISR ILSNVTGREHQRANNRLRQLLAAYKQVEMLLRLGEYQTG" BASE COUNT 57 a 77 c 75 g 42 t ORIGIN 1 tcgagcagga ttcgatgaac gatccggtcg ccgacgaagt gcgctcgctg ctcgacgggc 61 acatcgtact gtcgcgcaaa ctggccgagc gcgggcacta cccggcgatc gatgtgtcgg 121 ccagcatcag ccggattctg agcaacgtca ccggtcgcga acatcaacgg gcgaacaatc 181 gcctgcgcca gttactggct gcctataaac aagtggaaat gctcctgcgc ctgggtgaat 241 accaaaccgg a //