LOCUS AY457025 254 bp DNA linear BCT 26-JUL-2016 DEFINITION Pseudomonas caricapapayae strain LMG 2152 type III secretion system protein (hrcN) gene, partial cds. ACCESSION AY457025 VERSION AY457025.1 KEYWORDS . SOURCE Pseudomonas caricapapayae ORGANISM Pseudomonas caricapapayae Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas. REFERENCE 1 (bases 1 to 254) AUTHORS Rezzonico,F., Defago,G. and Moenne-Loccoz,Y. CONSRTM ETH Zuerich TITLE Comparison of ATPase-encoding type III secretion system hrcN genes in biocontrol fluorescent Pseudomonads and in phytopathogenic proteobacteria JOURNAL Appl. Environ. Microbiol. 70 (9), 5119-5131 (2004) PUBMED 15345390 REFERENCE 2 (bases 1 to 254) AUTHORS Rezzonico,F., Moenne-Loccoz,Y. and Defago,G. CONSRTM ETH Zuerich TITLE Direct Submission JOURNAL Submitted (04-NOV-2003) Plant Pathology, Eth Zuerich, Universitaetstr. 2, Zuerich 8092, Switzerland FEATURES Location/Qualifiers source 1..254 /organism="Pseudomonas caricapapayae" /mol_type="genomic DNA" /strain="LMG 2152" /type_material="type strain of Pseudomonas caricapapayae" /db_xref="taxon:46678" gene <1..>254 /gene="hrcN" CDS <1..>254 /gene="hrcN" /note="contains ATPase domain; probable inner membrane component of type III protein secretion system" /codon_start=3 /transl_table=11 /product="type III secretion system protein" /protein_id="AAR21340.1" /translation="VEQDSMNDPVADEVRSLLDGHIVLSRKLAERGHYPAIDVSASIS RILSNVTGREHQRANNRLRQLLAAYKQVEMLLRLGEYQXG" BASE COUNT 55 a 84 c 74 g 40 t ORIGIN 1 ccgtcgagca ggattcgatg aacgatccgg tagcggatga agtgcgctca ctgctcgacg 61 gacacatcgt gctgtcccgc aagctggccg agcgcgggca ttaccccgcc attgacgtgt 121 ccgccagcat cagccggatc ctcagcaacg tcacgggccg cgaacaccag cgagccaaca 181 atcgtctgcg ccagctactg gccgcctaca agcaggtgga aatgctcctg cgtctgggtg 241 aataccaawc cgga //