LOCUS AY271902 547 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens programmed death ligand 2 type III isoform (PDL2) mRNA, partial cds; alternatively spliced. ACCESSION AY271902 VERSION AY271902.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 547) AUTHORS He,X., Liu,Y., Xu,L. and Zeng,Y. TITLE Identification of PDL2 isoforms generated from alternative splicing in human peripheral mononuclear cells JOURNAL Unpublished REFERENCE 2 (bases 1 to 547) AUTHORS He,X., Liu,Y., Xu,L. and Zeng,Y. TITLE Direct Submission JOURNAL Submitted (08-APR-2003) Key Laboratory of Ministry of Education for Tissue Transplantation and Immunology, Jinan University, 601 Huangpu Road West, Guangzhou, Guangdong 510632, China FEATURES Location/Qualifiers source 1..547 /db_xref="H-InvDB:HIT000251344" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="9" /map="9p24.2" /cell_type="activated peripheral leukocytes" gene 1..>547 /gene="PDL2" CDS 1..>547 /gene="PDL2" /note="alternatively spliced; lacks exon 3 and 5bp of exon 4; PDL2 type III isoform" /codon_start=1 /product="programmed death ligand 2 type III isoform" /protein_id="AAP49001.1" /translation="MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNF DTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQC IIIYGVAWDYKYLTLKVKDGTQDPSNLAASHFHPLLHHCFHFHSHSDSPKKTTLSKAV FFKRHNKKTCHHNKEGSEQCYL" primer_bind 1..24 primer_bind complement(528..547) BASE COUNT 170 a 138 c 116 g 123 t ORIGIN 1 atgatcttcc tcctgctaat gttgagcctg gaattgcagc ttcaccagat agcagcttta 61 ttcacagtga cagtccctaa ggaactgtac ataatagagc atggcagcaa tgtgaccctg 121 gaatgcaact ttgacactgg aagtcatgtg aaccttggag caataacagc cagtttgcaa 181 aaggtggaaa atgatacatc cccacaccgt gaaagagcca ctttgctgga ggagcagctg 241 cccctaggga aggcctcgtt ccacatacct caagtccaag tgagggacga aggacagtac 301 caatgcataa tcatctatgg ggtcgcctgg gactacaagt acctgactct gaaagtcaaa 361 gatggaaccc aggacccatc caacttggct gcttcacatt ttcatcccct cctgcatcat 421 tgctttcatt ttcatagcca cagtgatagc cctaagaaaa caactctgtc aaaagctgta 481 ttcttcaaaa gacacaacaa aaagacctgt caccacaaca aagagggaag tgaacagtgc 541 tatctga //