LOCUS       AY271902                 547 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens programmed death ligand 2 type III isoform (PDL2)
            mRNA, partial cds; alternatively spliced.
ACCESSION   AY271902
VERSION     AY271902.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 547)
  AUTHORS   He,X., Liu,Y., Xu,L. and Zeng,Y.
  TITLE     Identification of PDL2 isoforms generated from alternative splicing
            in human peripheral mononuclear cells
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 547)
  AUTHORS   He,X., Liu,Y., Xu,L. and Zeng,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-APR-2003) Key Laboratory of Ministry of Education for
            Tissue Transplantation and Immunology, Jinan University, 601
            Huangpu Road West, Guangzhou, Guangdong 510632, China
FEATURES             Location/Qualifiers
     source          1..547
                     /db_xref="H-InvDB:HIT000251344"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="9"
                     /map="9p24.2"
                     /cell_type="activated peripheral leukocytes"
     gene            1..>547
                     /gene="PDL2"
     CDS             1..>547
                     /gene="PDL2"
                     /note="alternatively spliced; lacks exon 3 and 5bp of exon
                     4; PDL2 type III isoform"
                     /codon_start=1
                     /product="programmed death ligand 2 type III isoform"
                     /protein_id="AAP49001.1"
                     /translation="MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNF
                     DTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQC
                     IIIYGVAWDYKYLTLKVKDGTQDPSNLAASHFHPLLHHCFHFHSHSDSPKKTTLSKAV
                     FFKRHNKKTCHHNKEGSEQCYL"
     primer_bind     1..24
     primer_bind     complement(528..547)
BASE COUNT          170 a          138 c          116 g          123 t
ORIGIN      
        1 atgatcttcc tcctgctaat gttgagcctg gaattgcagc ttcaccagat agcagcttta
       61 ttcacagtga cagtccctaa ggaactgtac ataatagagc atggcagcaa tgtgaccctg
      121 gaatgcaact ttgacactgg aagtcatgtg aaccttggag caataacagc cagtttgcaa
      181 aaggtggaaa atgatacatc cccacaccgt gaaagagcca ctttgctgga ggagcagctg
      241 cccctaggga aggcctcgtt ccacatacct caagtccaag tgagggacga aggacagtac
      301 caatgcataa tcatctatgg ggtcgcctgg gactacaagt acctgactct gaaagtcaaa
      361 gatggaaccc aggacccatc caacttggct gcttcacatt ttcatcccct cctgcatcat
      421 tgctttcatt ttcatagcca cagtgatagc cctaagaaaa caactctgtc aaaagctgta
      481 ttcttcaaaa gacacaacaa aaagacctgt caccacaaca aagagggaag tgaacagtgc
      541 tatctga
//