LOCUS AM265369 372 bp DNA linear BCT 16-DEC-2008 DEFINITION Sinorhizobium meliloti partial avhB11 gene, type strain LMG 6133T. ACCESSION AM265369 VERSION AM265369.1 KEYWORDS avhB11 gene; AvhB11 protein. SOURCE Sinorhizobium meliloti ORGANISM Sinorhizobium meliloti Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium. REFERENCE 1 (bases 1 to 372) AUTHORS Moulin L. JOURNAL Submitted (15-MAY-2006) to the INSDC. Moulin L., LSTM UMR113 (IRD/CIRAD/INRA/AGROM/UMII), Institut de Recherche et Developpement, TA10/J Campus de Baillarguet, 34398 Montpellier cedex 5, FRANCE. REFERENCE 2 AUTHORS Moulin L., Jobbings C., Ghazoui Z., Young P. TITLE Comparative genomics in Sinorhizobium reveals Type Four Secretion Systems are a common feature of symbiotic plasmids JOURNAL Unpublished. FEATURES Location/Qualifiers source 1..372 /organism="Sinorhizobium meliloti" /host="Medicago sativa" /strain="type strain: LMG 6133" /mol_type="genomic DNA" /db_xref="taxon:382" CDS <1..>372 /codon_start=2 /transl_table=11 /gene="avhB11" /product="AvhB11" /function="conjugal transfer Type IV secretory pathway component AvhB11 and related ATPase" /db_xref="InterPro:IPR001482" /db_xref="InterPro:IPR027417" /db_xref="UniProtKB/TrEMBL:B7FAZ5" /protein_id="CAK22347.1" /translation="NDLKEREFFSETRSANDGASTRDEGLLALYRAGRFKEFLRQAVI SRKNIIISGATGSGKTTLSKALIKHIPEHERIISIEDTPELIIPQPNHVRLFYSNGAQ GLSGAGPKELLESCLRMRPDR" BASE COUNT 87 a 111 c 101 g 73 t ORIGIN 1 caatgatctg aaagagagag agtttttctc agagacgcga tcggccaacg acggcgcctc 61 gacgcgggac gagggcttgc tggcgcttta ccgtgccggc cgcttcaagg aatttttgcg 121 acaagccgtc atttcacgga agaacatcat catctcaggc gcaaccggtt cgggcaagac 181 gactctctcg aaagcgctga ttaaacacat tcccgagcat gagcggatca tttcgatcga 241 ggacacaccc gaactcatta ttccgcagcc caaccacgtg cgcctattct attcgaacgg 301 tgcccaggga ctctcggggg ctggccccaa agagctgctc gaatcctgtc tccggatgcg 361 gccggaccga at //