LOCUS       AM182089                 286 bp    DNA     linear   BCT 12-MAR-2007
DEFINITION  Sinorhizobium meliloti partial dnaK gene for molecular chaperone
            Hsp70, stain LMG 6133.
ACCESSION   AM182089
VERSION     AM182089.1
KEYWORDS    dnaK gene; molecular chaperone Hsp70.
SOURCE      Sinorhizobium meliloti
  ORGANISM  Sinorhizobium meliloti
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium.
REFERENCE   1  (bases 1 to 286)
  AUTHORS   Martens M.G.Y.
  JOURNAL   Submitted (10-JAN-2006) to the INSDC. Martens M.G.Y., Laboratory of
            Microbiology, Faculty of Science, University Gent, Ledeganckstraat
            35, B-9000, BELGIUM.
REFERENCE   2
  AUTHORS   Martens M., Delaere M., Coopman R., De Vos P., Gillis M.,
            Willems A.
  TITLE     Multilocus sequence analysis of Ensifer and related taxa
  JOURNAL   Int. J. Syst. Evol. Microbiol. 57(Pt 3), 489-503(2007).
   PUBMED   17329774
FEATURES             Location/Qualifiers
     source          1..286
                     /organism="Sinorhizobium meliloti"
                     /strain="LMG 6133"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:382"
     CDS             <1..>286
                     /codon_start=2
                     /transl_table=11
                     /gene="dnaK"
                     /product="molecular chaperone Hsp70"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:Q14S99"
                     /protein_id="CAJ57732.1"
                     /translation="ASGGLSDAEIEKMVKDAEANAEADKKRREGVEAKNQAESLVHSS
                     EKSLQEHGDKVSETDRKAIEDAIAALKSAVEVSEPDAEDIKAKTNTLMEVS"
BASE COUNT           76 a           81 c           90 g           39 t
ORIGIN      
        1 ggcctccggt ggtctttccg acgccgagat cgagaagatg gtcaaggatg ccgaagccaa
       61 tgcggaagcc gacaagaagc gccgcgaagg cgtagaggcc aagaaccagg ccgaaagcct
      121 ggtccattct tcggagaagt cgctccagga acatggcgac aaggtttccg agacggaccg
      181 taaggcgatc gaggatgcaa tcgcagcgct caagagcgcc gtcgaagttt ccgagccgga
      241 cgccgaggac atcaaggcca agaccaatac cctcatggaa gtctcc
//