LOCUS AM182089 286 bp DNA linear BCT 12-MAR-2007 DEFINITION Sinorhizobium meliloti partial dnaK gene for molecular chaperone Hsp70, stain LMG 6133. ACCESSION AM182089 VERSION AM182089.1 KEYWORDS dnaK gene; molecular chaperone Hsp70. SOURCE Sinorhizobium meliloti ORGANISM Sinorhizobium meliloti Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium. REFERENCE 1 (bases 1 to 286) AUTHORS Martens M.G.Y. JOURNAL Submitted (10-JAN-2006) to the INSDC. Martens M.G.Y., Laboratory of Microbiology, Faculty of Science, University Gent, Ledeganckstraat 35, B-9000, BELGIUM. REFERENCE 2 AUTHORS Martens M., Delaere M., Coopman R., De Vos P., Gillis M., Willems A. TITLE Multilocus sequence analysis of Ensifer and related taxa JOURNAL Int. J. Syst. Evol. Microbiol. 57(Pt 3), 489-503(2007). PUBMED 17329774 FEATURES Location/Qualifiers source 1..286 /organism="Sinorhizobium meliloti" /strain="LMG 6133" /mol_type="genomic DNA" /db_xref="taxon:382" CDS <1..>286 /codon_start=2 /transl_table=11 /gene="dnaK" /product="molecular chaperone Hsp70" /db_xref="InterPro:IPR013126" /db_xref="InterPro:IPR029048" /db_xref="UniProtKB/TrEMBL:Q14S99" /protein_id="CAJ57732.1" /translation="ASGGLSDAEIEKMVKDAEANAEADKKRREGVEAKNQAESLVHSS EKSLQEHGDKVSETDRKAIEDAIAALKSAVEVSEPDAEDIKAKTNTLMEVS" BASE COUNT 76 a 81 c 90 g 39 t ORIGIN 1 ggcctccggt ggtctttccg acgccgagat cgagaagatg gtcaaggatg ccgaagccaa 61 tgcggaagcc gacaagaagc gccgcgaagg cgtagaggcc aagaaccagg ccgaaagcct 121 ggtccattct tcggagaagt cgctccagga acatggcgac aaggtttccg agacggaccg 181 taaggcgatc gaggatgcaa tcgcagcgct caagagcgcc gtcgaagttt ccgagccgga 241 cgccgaggac atcaaggcca agaccaatac cctcatggaa gtctcc //