LOCUS AK312550 761 bp mRNA linear HTC 24-MAY-2008 DEFINITION Homo sapiens cDNA, FLJ92923, Homo sapiens leucine zipper and CTNNBIP1 domain containing (LZIC),mRNA. ACCESSION AK312550 VERSION AK312550.1 KEYWORDS HTC; HTC_FLI; oligo capping. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 761) AUTHORS Isogai,T. and Yamamoto,J. TITLE Direct Submission JOURNAL Submitted (11-JAN-2008) to the DDBJ/EMBL/GenBank databases. Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11 Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com REFERENCE 2 AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Kaida,T., Tsuchiya,K., Iida,Y., Takayama,Y., Murakawa,K., Kanehori,K., Andoh,T., Kagawa,N., Sato,R., Kawamura,Y., Tanaka,S., Kisu,Y., Sugano,S., Goshima,N., Nomura,N. and Isogai,T. TITLE NEDO functional analysis of protein and research application project JOURNAL Unpublished (2008) COMMENT Human cDNA sequencing project focused on splicing variants of mRNA in NEDO functional analysis of protein and research application project supported by Ministry of Economy, Trade and Industry, Japan; cDNA selection for complete cds sequencing: Reverse Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan (Hitachi) and Japan Biological Informatics Consortium, Japan (JBIC); cDNA complete cds sequencing: JBIC and Biological Information Research Center (BIRC), AIST; cDNA library construction: Helix Research Institute supported by Japan Key Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing: Research Association for Biotechnology, Japan, Biotechnology Center, National Institute of Technology and Evaluation, Japan and HRI; cDNA mapping to human genome: Central Research Laboratory, Hitachi; evaluation and annotation: REPRORI. FEATURES Location/Qualifiers source 1..761 /clone="CTONG3004656" /clone_lib="CTONG3" /db_xref="H-InvDB:HIT000431416" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector: pME18SFL3" /note="tumor tissue" /organism="Homo sapiens" /tissue_type="tongue, tumor tissue" CDS 189..761 /note="Homo sapiens leucine zipper and CTNNBIP1 domain containing (LZIC),mRNA" /protein_id="BAG35447.1" /translation="MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEE TKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQ PGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRKLGEKLTADDEAFLSANAGAI LSQFEKVSTDLGSGDKILALASFEVEKTKK" BASE COUNT 261 a 137 c 187 g 176 t ORIGIN 1 ccgccaggcc agtgccctca gcatctccac cccgaggtgg tttgaacttt gagccttttg 61 tagtcctgat gaataatttc attttcctca agtttatgac actcggaacg tcaagaactg 121 gaggtttgtg caatttgaga ccggtcggca ctgtgcagag atcagagtac taagagacag 181 agattaaaat ggcttccaga ggaaagacag agacaagcaa attaaagcag aatttagaag 241 aacagttgga tagactcatg caacaattac aagatctgga ggaatgcaga gaggaacttg 301 atacagatga atatgaagaa accaaaaagg aaactctgga gcaactaagt gaatttaatg 361 attcactaaa gaaaattatg tctggaaata tgactttggt agatgaacta agtggaatgc 421 agctggctat tcaggcagct atcagccagg cctttaaaac cccagaggtc atcagattgt 481 ttgcaaagaa acaaccaggt cagcttcgga caaggttagc agagatggat agagatctga 541 tggtaggaaa gctggaaaga gacctgtaca ctcaacagaa agtggagata ctaacagctc 601 ttaggaaact tggagagaag ctgactgcag atgatgaggc cttcttgtca gcaaatgcag 661 gtgctatact cagccagttt gagaaagtct ctacagacct tggctctgga gacaaaattc 721 ttgctctggc aagttttgag gttgaaaaaa caaaaaaatg a //