LOCUS AJ584695 374 bp DNA linear BCT 30-SEP-2005 DEFINITION Sinorhizobium meliloti psymA plasmid partial nifD gene, strain USDA1002. ACCESSION AJ584695 VERSION AJ584695.1 KEYWORDS nifD gene; NifD protein. SOURCE Sinorhizobium meliloti ORGANISM Sinorhizobium meliloti Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium. REFERENCE 1 (bases 1 to 374) AUTHORS Bena G. JOURNAL Submitted (30-SEP-2003) to the INSDC. Bena G., LSTM/IRD, Campus de Baillarguet TA10/J, Monptellier 34398, France. REFERENCE 2 AUTHORS Bena G., Lyet A., Huguet T., Olivieri I. TITLE Evolution of symbiotic specificity in the genus Medicago. Geographical implications and potential coevolution process JOURNAL Unpublished. FEATURES Location/Qualifiers source 1..374 /organism="Sinorhizobium meliloti" /plasmid="psymA" /strain="USDA1002" /mol_type="genomic DNA" /isolation_source="Medicago sativa" /db_xref="taxon:382" CDS <1..>374 /codon_start=3 /transl_table=11 /gene="nifD" /product="NifD protein" /db_xref="GOA:Q3LF81" /db_xref="InterPro:IPR000318" /db_xref="InterPro:IPR000510" /db_xref="InterPro:IPR010143" /db_xref="UniProtKB/TrEMBL:Q3LF81" /protein_id="CAE48331.1" /translation="KDXVFGGDKKLEKIIDEIEELFPLNNGVTVQSECPIGLIGDDIE AVSRKKAEEYKTTIVPVRCEGFRGVSQSLGHHIANDAIRDWVFDTTEVAYEAGRYDVN VIGDYNIGGDAWASRILLEEIG" BASE COUNT 92 a 85 c 117 g 79 t ORIGIN 1 agaaggatat ngtcttcggt ggtgacaaga agctagaaaa gatcatcgac gagatcgagg 61 aactgtttcc gctgaacaac ggtgttaccg tgcagtcgga atgtcccatc ggcttgattg 121 gtgacgacat cgaggcggtt tcgcgaaaga aggctgagga gtacaaaaca acaatcgtgc 181 cggtgcgttg cgaaggcttc cgcggtgtat cgcagtccct cggacatcac attgctaacg 241 acgcgatacg tgattgggtt ttcgacacga ccgaggtcgc gtacgaagct ggtcgatacg 301 acgttaacgt gatcggtgac tacaatatcg gcggtgacgc ctgggcatcg cgcatcctgc 361 tagaggagat cggg //