LOCUS AJ294400 443 bp DNA linear BCT 15-APR-2005 DEFINITION Sinorhizobium meliloti partial atpD gene for ATP synthase beta subunit, strain USDA 1002. ACCESSION AJ294400 VERSION AJ294400.1 KEYWORDS ATP synthase beta subunit; atpD gene. SOURCE Sinorhizobium meliloti ORGANISM Sinorhizobium meliloti Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium. REFERENCE 1 (bases 1 to 443) AUTHORS Young J.P.W. JOURNAL Submitted (21-AUG-2000) to the INSDC. Young J.P.W., Department of Biology, University of York, P O Box 373, York YO10 5YW, United Kingdom. REFERENCE 3 AUTHORS Gaunt M.W., Turner S.L., Rigottier-Gois L., Lloyd-Mcgilp S.A., Young J.P.W. TITLE Phylogenies of atpD and recA support the small subunit rRNA-based classification of rhizobia JOURNAL Int. J. Syst. Evol. Microbiol. 51(Pt 6), 2037-2048(0). PUBMED 11760945 FEATURES Location/Qualifiers source 1..443 /organism="Sinorhizobium meliloti" /strain="USDA 1002" /mol_type="genomic DNA" /db_xref="taxon:382" CDS <1..>443 /codon_start=1 /transl_table=11 /gene="atpD" /product="ATP synthase beta subunit" /db_xref="GOA:Q9FBH4" /db_xref="InterPro:IPR000194" /db_xref="InterPro:IPR027417" /db_xref="UniProtKB/TrEMBL:Q9FBH4" /protein_id="CAC04410.1" /translation="PLKTSARRAIQPEAPAYVDQSTEAQILVTGIKVVDLLAPYAKGG KIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVNKH GGGEGSKAALVYGQMNEPPGARARVALTGLTVAEQFRDEGQDFLF" BASE COUNT 86 a 147 c 139 g 70 t ORIGIN 1 ccgctgaaga cttccgcccg ccgcgccatc caaccagaag cgccggctta tgtggaccag 61 tcgacggaag cgcagattct cgtcaccggc atcaaggtcg tcgacctgct cgctccctat 121 gcgaagggcg gcaagatcgg cctcttcggc ggcgcgggcg tcggcaagac cgtgctgatc 181 atggaactga tcaacaacgt cgccaaggcg cacggcggtt actccgtctt cgcaggcgtc 241 ggtgaacgga cccgcgaagg caacgacctc tatcacgaaa tgatcgagtc cggcgtgaac 301 aagcatggcg gcggcgaagg ttccaaggcc gcgctcgtct acggccagat gaacgagccg 361 ccgggcgccc gcgcacgcgt cgcgctgacc ggcctgacgg tcgccgaaca gttccgtgac 421 gaaggccagg actttctstt ctt //