LOCUS       AJ294400                 443 bp    DNA     linear   BCT 15-APR-2005
DEFINITION  Sinorhizobium meliloti partial atpD gene for ATP synthase beta
            subunit, strain USDA 1002.
ACCESSION   AJ294400
VERSION     AJ294400.1
KEYWORDS    ATP synthase beta subunit; atpD gene.
SOURCE      Sinorhizobium meliloti
  ORGANISM  Sinorhizobium meliloti
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium.
REFERENCE   1  (bases 1 to 443)
  AUTHORS   Young J.P.W.
  JOURNAL   Submitted (21-AUG-2000) to the INSDC. Young J.P.W., Department of
            Biology, University of York, P O Box 373, York YO10 5YW, United
            Kingdom.
REFERENCE   3
  AUTHORS   Gaunt M.W., Turner S.L., Rigottier-Gois L., Lloyd-Mcgilp S.A.,
            Young J.P.W.
  TITLE     Phylogenies of atpD and recA support the small subunit rRNA-based
            classification of rhizobia
  JOURNAL   Int. J. Syst. Evol. Microbiol. 51(Pt 6), 2037-2048(0).
   PUBMED   11760945
FEATURES             Location/Qualifiers
     source          1..443
                     /organism="Sinorhizobium meliloti"
                     /strain="USDA 1002"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:382"
     CDS             <1..>443
                     /codon_start=1
                     /transl_table=11
                     /gene="atpD"
                     /product="ATP synthase beta subunit"
                     /db_xref="GOA:Q9FBH4"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q9FBH4"
                     /protein_id="CAC04410.1"
                     /translation="PLKTSARRAIQPEAPAYVDQSTEAQILVTGIKVVDLLAPYAKGG
                     KIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVNKH
                     GGGEGSKAALVYGQMNEPPGARARVALTGLTVAEQFRDEGQDFLF"
BASE COUNT           86 a          147 c          139 g           70 t
ORIGIN      
        1 ccgctgaaga cttccgcccg ccgcgccatc caaccagaag cgccggctta tgtggaccag
       61 tcgacggaag cgcagattct cgtcaccggc atcaaggtcg tcgacctgct cgctccctat
      121 gcgaagggcg gcaagatcgg cctcttcggc ggcgcgggcg tcggcaagac cgtgctgatc
      181 atggaactga tcaacaacgt cgccaaggcg cacggcggtt actccgtctt cgcaggcgtc
      241 ggtgaacgga cccgcgaagg caacgacctc tatcacgaaa tgatcgagtc cggcgtgaac
      301 aagcatggcg gcggcgaagg ttccaaggcc gcgctcgtct acggccagat gaacgagccg
      361 ccgggcgccc gcgcacgcgt cgcgctgacc ggcctgacgg tcgccgaaca gttccgtgac
      421 gaaggccagg actttctstt ctt
//