LOCUS AJ294382 533 bp DNA linear BCT 15-APR-2005 DEFINITION Sinorhizobium meliloti partial recA gene, strain USDA 1002. ACCESSION AJ294382 VERSION AJ294382.1 KEYWORDS recA gene; recA protein. SOURCE Sinorhizobium meliloti ORGANISM Sinorhizobium meliloti Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium. REFERENCE 1 (bases 1 to 533) AUTHORS Young J.P.W. JOURNAL Submitted (21-AUG-2000) to the INSDC. Young J.P.W., Department of Biology, University of York, P O Box 373, York YO10 5YW, United Kingdom. REFERENCE 3 AUTHORS Gaunt M.W., Turner S.L., Rigottier-Gois L., Lloyd-Mcgilp S.A., Young J.P.W. TITLE Phylogenies of atpD and recA support the small subunit rRNA-based classification of rhizobia JOURNAL Int. J. Syst. Evol. Microbiol. 51(Pt 6), 2037-2048(2001). PUBMED 11760945 FEATURES Location/Qualifiers source 1..533 /organism="Sinorhizobium meliloti" /strain="USDA 1002" /mol_type="genomic DNA" /db_xref="taxon:382" CDS <1..>533 /codon_start=3 /transl_table=11 /gene="recA" /product="RecA protein" /db_xref="GOA:Q9FBH5" /db_xref="InterPro:IPR003593" /db_xref="InterPro:IPR013765" /db_xref="InterPro:IPR020588" /db_xref="InterPro:IPR027417" /db_xref="UniProtKB/TrEMBL:Q9FBH5" /protein_id="CAC04409.1" /translation="LEAALSQIERSFGKGSIMKLGAKDSVVEIETVSTGSLGLDIALG IGGLPKGRIIEIYGPESSGKTTLALQTIAEAQKKGGICGFVDAEHALDPVYARKLGVD LENLLISQPDTGEQALEITDTLVRSGAIDILVIDSVAALVPRAEIEGEMGDSLPGMQA RLMSQALRKLTASISKS" BASE COUNT 107 a 157 c 170 g 99 t ORIGIN 1 cacttgaagc ggctctttcc cagatcgaac gttcgttcgg caagggatcg atcatgaagc 61 tcggagcgaa ggacagcgta gttgagatcg aaaccgtctc caccggttcg ctcggcctcg 121 atatcgcgct cggcatcggc ggcctgccga agggccgtat catcgagatc tatggtccgg 181 aaagctcggg caagacgacg ctggcgctgc agaccattgc cgaggcacag aagaagggcg 241 gcatctgcgg cttcgtcgat gccgagcatg cactcgatcc ggtctatgca cgaaagctcg 301 gggtcgatct cgaaaatctc ctgatttcgc agcctgatac gggcgagcag gcgctggaaa 361 tcaccgatac gctggtccgt tcgggtgcga tcgacattct cgtcatcgat tcggtggccg 421 cactcgtgcc gcgcgccgaa atcgagggcg agatgggcga cagtctgccg ggcatgcagg 481 cgcgcctcat gagccaggcg ctgcgcaagc ttacggcatc gatctccaag tcg //