LOCUS       AJ294382                 533 bp    DNA     linear   BCT 15-APR-2005
DEFINITION  Sinorhizobium meliloti partial recA gene, strain USDA 1002.
ACCESSION   AJ294382
VERSION     AJ294382.1
KEYWORDS    recA gene; recA protein.
SOURCE      Sinorhizobium meliloti
  ORGANISM  Sinorhizobium meliloti
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium.
REFERENCE   1  (bases 1 to 533)
  AUTHORS   Young J.P.W.
  JOURNAL   Submitted (21-AUG-2000) to the INSDC. Young J.P.W., Department of
            Biology, University of York, P O Box 373, York YO10 5YW, United
            Kingdom.
REFERENCE   3
  AUTHORS   Gaunt M.W., Turner S.L., Rigottier-Gois L., Lloyd-Mcgilp S.A.,
            Young J.P.W.
  TITLE     Phylogenies of atpD and recA support the small subunit rRNA-based
            classification of rhizobia
  JOURNAL   Int. J. Syst. Evol. Microbiol. 51(Pt 6), 2037-2048(2001).
   PUBMED   11760945
FEATURES             Location/Qualifiers
     source          1..533
                     /organism="Sinorhizobium meliloti"
                     /strain="USDA 1002"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:382"
     CDS             <1..>533
                     /codon_start=3
                     /transl_table=11
                     /gene="recA"
                     /product="RecA protein"
                     /db_xref="GOA:Q9FBH5"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013765"
                     /db_xref="InterPro:IPR020588"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q9FBH5"
                     /protein_id="CAC04409.1"
                     /translation="LEAALSQIERSFGKGSIMKLGAKDSVVEIETVSTGSLGLDIALG
                     IGGLPKGRIIEIYGPESSGKTTLALQTIAEAQKKGGICGFVDAEHALDPVYARKLGVD
                     LENLLISQPDTGEQALEITDTLVRSGAIDILVIDSVAALVPRAEIEGEMGDSLPGMQA
                     RLMSQALRKLTASISKS"
BASE COUNT          107 a          157 c          170 g           99 t
ORIGIN      
        1 cacttgaagc ggctctttcc cagatcgaac gttcgttcgg caagggatcg atcatgaagc
       61 tcggagcgaa ggacagcgta gttgagatcg aaaccgtctc caccggttcg ctcggcctcg
      121 atatcgcgct cggcatcggc ggcctgccga agggccgtat catcgagatc tatggtccgg
      181 aaagctcggg caagacgacg ctggcgctgc agaccattgc cgaggcacag aagaagggcg
      241 gcatctgcgg cttcgtcgat gccgagcatg cactcgatcc ggtctatgca cgaaagctcg
      301 gggtcgatct cgaaaatctc ctgatttcgc agcctgatac gggcgagcag gcgctggaaa
      361 tcaccgatac gctggtccgt tcgggtgcga tcgacattct cgtcatcgat tcggtggccg
      421 cactcgtgcc gcgcgccgaa atcgagggcg agatgggcga cagtctgccg ggcatgcagg
      481 cgcgcctcat gagccaggcg ctgcgcaagc ttacggcatc gatctccaag tcg
//