LOCUS       AJ289122                 399 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens partial mRNA for CD1E antigen, isoform 12 (CD1E gene).
ACCESSION   AJ289122
VERSION     AJ289122.1
KEYWORDS    CD1E gene; CD1e protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 399)
  AUTHORS   De la salle H.
  JOURNAL   Submitted (16-MAY-2000) to the INSDC. de la Salle H., INSERM EPI
            99-08, EFS Alsace, 10 Rue Spielmann BP65, 67065, FRANCE.
REFERENCE   3
  AUTHORS   Angenieux C., Salamero J., Fricker D., Cazenave J.P., Goud B.,
            Hanau D., De la salle H.
  TITLE     Characterization of CD1e, a third type of CD1 molecule expressed in
            dendritic cells
  JOURNAL   J Biol Chem 275(48), 37757-37764(2000).
   PUBMED   10948205
FEATURES             Location/Qualifiers
     source          1..399
                     /db_xref="H-InvDB:HIT000246536"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /country="France"
                     /cell_type="dendritic cells"
                     /db_xref="taxon:9606"
     CDS             <1..>396
                     /codon_start=1
                     /gene="CD1E"
                     /product="CD1E antigen, isoform 12"
                     /db_xref="GOA:P15812"
                     /db_xref="H-InvDB:HIT000246536.13"
                     /db_xref="HGNC:HGNC:1638"
                     /db_xref="InterPro:IPR003597"
                     /db_xref="InterPro:IPR007110"
                     /db_xref="InterPro:IPR011161"
                     /db_xref="InterPro:IPR011162"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR036179"
                     /db_xref="InterPro:IPR037055"
                     /db_xref="PDB:3S6C"
                     /db_xref="UniProtKB/Swiss-Prot:P15812"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /protein_id="CAB93161.1"
                     /translation="MLLLFLLFEGLCCPGENTAVKPEAWLSCGPSPGPGRLQLVCHVS
                     GFYPKPVWVMWMRGGYSIFLILICLTVIVTLVILVVVDSRLKKQSPVFLMGANTQDTK
                     NSRHQFCLAQVSWIKNRVLKKWKTRLNQLW"
     sig_peptide     1..24
                     /gene="CD1E"
     mat_peptide     25..396
                     /gene="CD1E"
                     /product="CD1E antigen, isoform 12"
BASE COUNT           91 a           99 c          103 g          106 t
ORIGIN      
        1 atgctgctcc tgttcctcct cttcgagggt ctctgctgtc ctggggaaaa tacagcagtg
       61 aagccagagg cctggctgtc ctgtggcccc agtcctggcc ctggccgtct gcagcttgtg
      121 tgccatgtct caggattcta cccaaagccc gtgtgggtga tgtggatgcg gggtggatat
      181 tccatctttc tcatcctgat ctgtttgact gtgatagtta ccctggtcat attggttgta
      241 gttgactcac ggttaaaaaa acagagccct gtctttctca tgggagccaa cactcaggac
      301 accaagaatt caagacatca gttctgcttg gcacaagtat cgtggatcaa aaacagagta
      361 ttgaagaagt ggaagacacg cctaaaccaa ctctggtga
//