LOCUS AJ289122 399 bp mRNA linear HUM 07-OCT-2008 DEFINITION Homo sapiens partial mRNA for CD1E antigen, isoform 12 (CD1E gene). ACCESSION AJ289122 VERSION AJ289122.1 KEYWORDS CD1E gene; CD1e protein. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 399) AUTHORS De la salle H. JOURNAL Submitted (16-MAY-2000) to the INSDC. de la Salle H., INSERM EPI 99-08, EFS Alsace, 10 Rue Spielmann BP65, 67065, FRANCE. REFERENCE 3 AUTHORS Angenieux C., Salamero J., Fricker D., Cazenave J.P., Goud B., Hanau D., De la salle H. TITLE Characterization of CD1e, a third type of CD1 molecule expressed in dendritic cells JOURNAL J Biol Chem 275(48), 37757-37764(2000). PUBMED 10948205 FEATURES Location/Qualifiers source 1..399 /db_xref="H-InvDB:HIT000246536" /organism="Homo sapiens" /mol_type="mRNA" /country="France" /cell_type="dendritic cells" /db_xref="taxon:9606" CDS <1..>396 /codon_start=1 /gene="CD1E" /product="CD1E antigen, isoform 12" /db_xref="GOA:P15812" /db_xref="H-InvDB:HIT000246536.13" /db_xref="HGNC:HGNC:1638" /db_xref="InterPro:IPR003597" /db_xref="InterPro:IPR007110" /db_xref="InterPro:IPR011161" /db_xref="InterPro:IPR011162" /db_xref="InterPro:IPR013783" /db_xref="InterPro:IPR036179" /db_xref="InterPro:IPR037055" /db_xref="PDB:3S6C" /db_xref="UniProtKB/Swiss-Prot:P15812" /experiment="experimental evidence, no additional details recorded" /protein_id="CAB93161.1" /translation="MLLLFLLFEGLCCPGENTAVKPEAWLSCGPSPGPGRLQLVCHVS GFYPKPVWVMWMRGGYSIFLILICLTVIVTLVILVVVDSRLKKQSPVFLMGANTQDTK NSRHQFCLAQVSWIKNRVLKKWKTRLNQLW" sig_peptide 1..24 /gene="CD1E" mat_peptide 25..396 /gene="CD1E" /product="CD1E antigen, isoform 12" BASE COUNT 91 a 99 c 103 g 106 t ORIGIN 1 atgctgctcc tgttcctcct cttcgagggt ctctgctgtc ctggggaaaa tacagcagtg 61 aagccagagg cctggctgtc ctgtggcccc agtcctggcc ctggccgtct gcagcttgtg 121 tgccatgtct caggattcta cccaaagccc gtgtgggtga tgtggatgcg gggtggatat 181 tccatctttc tcatcctgat ctgtttgact gtgatagtta ccctggtcat attggttgta 241 gttgactcac ggttaaaaaa acagagccct gtctttctca tgggagccaa cactcaggac 301 accaagaatt caagacatca gttctgcttg gcacaagtat cgtggatcaa aaacagagta 361 ttgaagaagt ggaagacacg cctaaaccaa ctctggtga //