LOCUS AJ288141 389 bp DNA linear BCT 15-APR-2005 DEFINITION Pseudomonas alcaligenes partial narH gene for nitrate reductase beta-subunit strain DSM 50342. ACCESSION AJ288141 VERSION AJ288141.1 KEYWORDS narH gene; nitrate reductase beta-subunit. SOURCE Pseudomonas alcaligenes ORGANISM Pseudomonas alcaligenes Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas. REFERENCE 1 (bases 1 to 389) AUTHORS Petri R. JOURNAL Submitted (15-MAR-2000) to the INSDC. Petri R., Marine Mikrobiologie, Institut fuer Meereskunde, Duesternbrooker Weg 20, 24105 Kiel, GERMANY. REFERENCE 3 AUTHORS Petri R., Imhoff J.F. TITLE The relationship of nitrate reducing bacteria on the basis of narH gene sequences and comparison of narH and 16S rDNA based phylogeny JOURNAL Syst. Appl. Microbiol. 23(1), 47-57(2000). PUBMED 10879978 FEATURES Location/Qualifiers source 1..389 /organism="Pseudomonas alcaligenes" /strain="DSM 50342" /mol_type="genomic DNA" /db_xref="taxon:43263" CDS <1..>389 /codon_start=1 /transl_table=11 /gene="narH" /product="nitrate reductase beta-subunit" /db_xref="UniProtKB/TrEMBL:Q9L345" /protein_id="CAB82170.1" /translation="CIGCHTCPVTCKNVWTSREGMEYAWFNNVETKPGIGYPKEWENQ ETWKGGWVRNKDGSINPKIGGKFRVLANIFSNPDLPSIDDYYEPFDFDYQHLHNAPLG NHQPVARPRSVISGKRMEKIEWGPNWE" BASE COUNT 95 a 121 c 116 g 56 t ORIGIN 1 tgcatcggct gccacacctg cccggtcacc tgcaagaacg tctggaccag ccgcgaaggc 61 atggaatacg cctggttcaa caacgtcgag accaagcccg gtatcggcta cccgaaagag 121 tgggaaaacc aggagacgtg gaaaggcggc tgggtacgca acaaggatgg ttcgatcaac 181 ccgaagatcg gcggcaagtt ccgcgtgctg gcgaacatct tctccaaccc ggacctgccg 241 agcatcgacg actactacga gccgttcgac ttcgactacc agcacctgca caacgcgccg 301 ctgggtaacc accaaccggt ggcccggccg cgttcggtga tctccggcaa acgcatggaa 361 aagatcgagt ggggcccgaa ctgggarga //