LOCUS       AJ288141                 389 bp    DNA     linear   BCT 15-APR-2005
DEFINITION  Pseudomonas alcaligenes partial narH gene for nitrate reductase
            beta-subunit strain DSM 50342.
ACCESSION   AJ288141
VERSION     AJ288141.1
KEYWORDS    narH gene; nitrate reductase beta-subunit.
SOURCE      Pseudomonas alcaligenes
  ORGANISM  Pseudomonas alcaligenes
            Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
            Pseudomonadaceae; Pseudomonas.
REFERENCE   1  (bases 1 to 389)
  AUTHORS   Petri R.
  JOURNAL   Submitted (15-MAR-2000) to the INSDC. Petri R., Marine
            Mikrobiologie, Institut fuer Meereskunde, Duesternbrooker Weg 20,
            24105 Kiel, GERMANY.
REFERENCE   3
  AUTHORS   Petri R., Imhoff J.F.
  TITLE     The relationship of nitrate reducing bacteria on the basis of narH
            gene sequences and comparison of narH and 16S rDNA based phylogeny
  JOURNAL   Syst. Appl. Microbiol. 23(1), 47-57(2000).
   PUBMED   10879978
FEATURES             Location/Qualifiers
     source          1..389
                     /organism="Pseudomonas alcaligenes"
                     /strain="DSM 50342"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:43263"
     CDS             <1..>389
                     /codon_start=1
                     /transl_table=11
                     /gene="narH"
                     /product="nitrate reductase beta-subunit"
                     /db_xref="UniProtKB/TrEMBL:Q9L345"
                     /protein_id="CAB82170.1"
                     /translation="CIGCHTCPVTCKNVWTSREGMEYAWFNNVETKPGIGYPKEWENQ
                     ETWKGGWVRNKDGSINPKIGGKFRVLANIFSNPDLPSIDDYYEPFDFDYQHLHNAPLG
                     NHQPVARPRSVISGKRMEKIEWGPNWE"
BASE COUNT           95 a          121 c          116 g           56 t
ORIGIN      
        1 tgcatcggct gccacacctg cccggtcacc tgcaagaacg tctggaccag ccgcgaaggc
       61 atggaatacg cctggttcaa caacgtcgag accaagcccg gtatcggcta cccgaaagag
      121 tgggaaaacc aggagacgtg gaaaggcggc tgggtacgca acaaggatgg ttcgatcaac
      181 ccgaagatcg gcggcaagtt ccgcgtgctg gcgaacatct tctccaaccc ggacctgccg
      241 agcatcgacg actactacga gccgttcgac ttcgactacc agcacctgca caacgcgccg
      301 ctgggtaacc accaaccggt ggcccggccg cgttcggtga tctccggcaa acgcatggaa
      361 aagatcgagt ggggcccgaa ctgggarga
//