LOCUS AB451238 579 bp mRNA linear HUM 02-SEP-2008 DEFINITION Homo sapiens RAC1 mRNA for ras-related C3 botulinum toxin substrate 1 isoform Rac1, complete cds, clone: FLJ08036AAAN. ACCESSION AB451238 VERSION AB451238.1 KEYWORDS Gateway cloning system. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 579) AUTHORS Kawamura,Y., Nomura,N. and Goshima,N. TITLE Direct Submission JOURNAL Submitted (31-JUL-2008) to the DDBJ/EMBL/GenBank databases. Contact:Naoki Goshima Biomedicinal Information Research Center (BIRC), National Institute of Advanced Industrial Science and Technology (AIST); 2-42 Aomi, Koto-ku, Tokyo 135-0064, Japan REFERENCE 2 AUTHORS Goshima,N., Kawamura,Y., Fukumoto,A., Miura,A., Honma,R., Satoh,R., Wakamatsu,A., Yamamoto,J.-I., Kimura,K., Nishikawa,T., Andoh,T., Iida,Y., Ishikawa,K., Ito,E., Kagawa,N., Kaminaga,C., Kanehori,K., Kawakami,B., Kenmochi,K.-I., Kimura,R., Kobayashi,M., Kuroita,T., Kuwayama,H., Maruyama,Y., Matsuo,K., Minami,K., Mitsubori,M., Mori,M., Morishita,R., Murase,A., Nishikawa,A., Nishikawa,S., Okamoto,T., Sakagami,N., Sakamoto,Y., Sasaki,Y., Seki,T., Sono,S., Sugiyama,A., Sumiya,T., Takayama,T., Takayama,Y., Takeda,H., Togashi,T., Yahata,K., Yamada,H., Yanagisawa,Y., Endo,Y., Imamoto,F., Kisu,Y., Tanaka,S., Isogai,T., Imai,J.-I., Watanabe,S. and Nomura,N. TITLE Human Protein Factory: an infrastructure to convert the human transcriptome into the in vitro-expressed human proteome of versatile utility JOURNAL Unpublished (2008) COMMENT This human Gateway entry clone was constructed by recombining an attB-attached open reading frame (ORF) fragment with attP sequences of the Gateway donor vector pDONR201. The ORF sequence in the entry clone is flanked with attL1 sequence (100 nt) - spacer nucleotides (TC) - Shine-Dalgano sequence (GAAGGAGATA) - spacer nucleotides (GA) - Kozak sequence (ACC) upstream of the translational initiation codon (ATG) and is also flanked with a spacer nucleotide (G) - attL2 sequence (99 nt) downstream of the ORF. This is an N-type clone which has an intrinsic stop codon at the end of ORF. DNA sequences of the entire ORF and flanking regions were validated by sequencing. Clone structure of the ORF and flanking sequences is as follows: 5'-caaataatgattttattttgactgatagtgacctgttcgttgcaacaaattgatgagcaatgct tttttataatgccaactttgtacaaaaaagcaggct TC GAAGGAGATA GA ACC 5'ORF3' G acccagctttcttgtacaaagttggcattataagaaagcattgcttatcaatttgttgcaacgaa caggtcactatcagtcaaaataaaatcattattg-3' (5'ORF3'; ORF sequence. attL sequences are described in lower cases). Clone information: http://www.HGPD.jp/ This clone was produced in the "Functional Analysis of Protein and Research Application" project supported by the New Energy and Industrial Technology Development Organization (NEDO), Japan FEATURES Location/Qualifiers source 1..579 /clone="FLJ08036AAAN" /db_xref="H-InvDB:HIT000487451" /db_xref="taxon:9606" /mol_type="mRNA" /note="Vector: pDONR201" /organism="Homo sapiens" CDS 1..579 /codon_start=1 /gene="RAC1" /product="ras-related C3 botulinum toxin substrate 1 isoform Rac1" /protein_id="BAG70052.1" /transl_table=1 /translation="MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANV MVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVR HHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSAL TQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL" BASE COUNT 159 a 133 c 145 g 142 t ORIGIN 1 atgcaggcca tcaagtgtgt ggtggtggga gacggagctg taggtaaaac ttgcctactg 61 atcagttaca caaccaatgc atttcctgga gaatatatcc ctactgtctt tgacaattat 121 tctgccaatg ttatggtaga tggaaaaccg gtgaatctgg gcttatggga tacagctgga 181 caagaagatt atgacagatt acgcccccta tcctatccgc aaacagatgt gttcttaatt 241 tgcttttccc ttgtgagtcc tgcatcattt gaaaatgtcc gtgcaaagtg gtatcctgag 301 gtgcggcacc actgtcccaa cactcccatc atcctagtgg gaactaaact tgatcttagg 361 gatgataaag acacgatcga gaaactgaag gagaagaagc tgactcccat cacctatccg 421 cagggtctag ccatggctaa ggagattggt gctgtaaaat acctggagtg ctcggcgctc 481 acacagcgag gcctcaagac agtgtttgac gaagcgatcc gagcagtcct ctgcccgcct 541 cccgtgaaga agaggaagag aaaatgcctg ctgttgtaa //