LOCUS       LC177179                 522 bp    DNA     linear   ENV 19-JAN-2018
DEFINITION  Uncultured euryarchaeote mcrA gene for methyl coenzyme M reductase
            alpha subunit, partial cds.
ACCESSION   LC177179
VERSION     LC177179.1
KEYWORDS    ENV.
SOURCE      uncultured euryarchaeote
  ORGANISM  uncultured euryarchaeote
            Archaea; Euryarchaeota; environmental samples.
REFERENCE   1  (bases 1 to 522)
  AUTHORS   Ino,K. and Suzuki,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-AUG-2016) to the DDBJ/EMBL/GenBank databases.
            Contact:Kohei Ino
            The University of Tokyo, Graduate School of Science; 7-3-1 Hongo,
            Bunkyo-ku, Tokyo 113-0033, Japan
            URL    :http://www.s.u-tokyo.ac.jp/
REFERENCE   2  
  AUTHORS   Ino,K., Hernsdorf,A.W., Konno,U., Kouduka,M., Yanagawa,K.,
            Kato,S., Sunamura,M., Hirota,A., Togo,Y.S., Ito,K., Fukuda,A.,
            Iwatsuki,T., Mizuno,T., Komatsu,D.D., Tsunogai,U., Ishimura,T.,
            Amano,Y., Thomas,B.C., Banfield,J.F. and Suzuki,Y.
  TITLE     Ecological and genomic profiling of anaerobic methane-oxidizing
            archaea in a deep granitic environment
  JOURNAL   ISME J 12, 31-47 (2018)
  REMARK    DOI:10.1038/ismej.2017.140
COMMENT     
FEATURES             Location/Qualifiers
     source          1..522
                     /clone="MIU_mcrA_1"
                     /collected_by="Graduate School of Science, The University
                     of Tokyo, Geological Survey of Japan, National Institute
                     of Advanced Industrial Science and Technology and Japan
                     Atomic Energy Agency"
                     /collection_date="2012-07-31/2015-12-22"
                     /country="Japan:Gifu, Mizunami, the Mizunami underground
                     research laboratory"
                     /db_xref="taxon:114243"
                     /environmental_sample
                     /isolation_source="deep groundwater"
                     /lat_lon="35.3783 N 137.2383 E"
                     /mol_type="genomic DNA"
                     /organism="uncultured euryarchaeote"
                     /PCR_primers="fwd_seq: gcmatgcarathggwatgtc, rev_seq:
                     tcatkgcrtagttdggrtagt"
     CDS             <1..>522
                     /codon_start=2
                     /gene="mcrA"
                     /product="methyl coenzyme M reductase alpha subunit"
                     /protein_id="BAX04340.1"
                     /transl_table=11
                     /translation="TAKHAGLVEMGDMIPARRARGPNEPGGVSFGHMCDFVQTSRKKP
                     DEREEAVLQVATASSMLYDQIWLGGYMSGGVGFTMYATPAYTNDILDDYLYWGSDYAK
                     KKYGGYGKAKATIEVVKDIITETTPYGLESYEKYPTTLEDHFGGSQRATTVALTSAGA
                     VGLATGNAQAALH"
BASE COUNT          157 a          129 c          144 g           92 t
ORIGIN      
        1 cacagccaag cacgctggac ttgtggaaat gggtgacatg atcccggcac gcagagcaag
       61 gggtccaaat gaaccaggtg gagtatcctt tggtcacatg tgcgatttcg tccagaccag
      121 caggaagaaa cctgatgaga gagaagaagc tgtactgcag gtagcaacag catcaagcat
      181 gctgtacgac cagatctggc tcggcggcta catgtcaggc ggcgtgggat tcacgatgta
      241 tgcaacacca gcgtacacca atgatatcct ggatgactat ctctactggg gctcagacta
      301 tgcgaaaaag aaatacggag gctatggaaa agcaaaggca accatcgaag ttgtaaaaga
      361 catcatcaca gagaccacac cgtatggtct tgagagctac gagaagtacc ccacaacgct
      421 tgaggaccac ttcggaggtt cgcagagagc aacaaccgtt gcgctcacaa gcgcaggagc
      481 ggtcggctta gcaacaggca atgctcaggc agctctccat aa
//