LOCUS       LC163891                1020 bp    DNA     linear   BCT 20-OCT-2016
DEFINITION  Streptomyces sp. SANK 60404 asd gene for aspartate-semialdehyde
            dehydrogenase, complete cds.
ACCESSION   LC163891
VERSION     LC163891.1
KEYWORDS    .
SOURCE      Streptomyces sp. SANK 60404
  ORGANISM  Streptomyces sp. SANK 60404
            Bacteria; Actinomycetota; Actinomycetes; Kitasatosporales;
            Streptomycetaceae; Streptomyces.
REFERENCE   1  (bases 1 to 1020)
  AUTHORS   Hasebe,F., Nishiyama,M. and Kuzuyama,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-JUN-2016) to the DDBJ/EMBL/GenBank databases.
            Contact:Fumihito Hasebe
            University of Shizuoka, School of Food and Nutritional
            Sciences/Graduate Division of Nutritional and Environmental
            Sciences; Yada 52-1, Suruga-ku, Shizuoka 422-8526, Japan
REFERENCE   2  
  AUTHORS   Hasebe,F., Matsuda,K., Shiraishi,T., Futamura,Y., Nakano,T.,
            Tomita,T., Ishigami,K., Taka,H., Mineki,R., Fujimura,T., Osada,H.,
            Kuzuyama,T. and Nishiyama,M.
  TITLE     Amino-group carrier-protein-mediated secondary metabolite
            biosynthesis in Streptomyces
  JOURNAL   Nat. Chem. Biol. 12, 967-972 (2016)
  REMARK    DOI:10.1038/nchembio.2181
COMMENT     
FEATURES             Location/Qualifiers
     source          1..1020
                     /db_xref="taxon:1213862"
                     /mol_type="genomic DNA"
                     /organism="Streptomyces sp. SANK 60404"
                     /strain="SANK 60404"
     CDS             1..1020
                     /codon_start=1
                     /gene="asd"
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="BAV57521.1"
                     /transl_table=11
                     /translation="MKVGIVGATGQVGTVMRKILAERKFPVDELRLFASARSAGSVLD
                     GVTVEDASTADYTGLDIVLFSAGGATSRALAEKVASQGAVVIDNSSAWRRDPEVPLVV
                     SEVNPHAIKDRPKGIIANPNCTTMAAMPVLKPLHQEAGLTALVATTYQAVSGSGLAGV
                     AELDGQVKAVAEKAAELTHDGEAVAYPEPGVYKRPIAFNVLPLAGSIVDDGSFETDEE
                     QKLRNESRKILELPDLKVSGTCVRVPVFSGHSLQVNARFERPISVERAYELLKDAEGV
                     ELSEIPTPLQAAGKDASYVGRIRVDETVENGLALFLSNDNLRKGAALNAVQIAELVAE
                     ELKGA"
BASE COUNT          158 a          371 c          347 g          144 t
ORIGIN      
        1 gtgaaggtcg gaatcgtcgg agccaccggt caggtcggca cggtcatgcg caagatcctt
       61 gccgagcgca agtttccggt cgacgagctg cggctgttcg cctccgcccg ttcggcgggc
      121 tccgtcctgg acggcgtgac cgtcgaggac gcctccacgg ccgactacac cggcctggac
      181 atcgtgctct tctcggccgg tggcgccacc tcccgggcgc tcgccgagaa ggtcgcctcg
      241 cagggtgccg tggtgatcga caactcctcc gcctggcgcc gggaccccga ggtgccgctg
      301 gtggtctccg aggtgaaccc ccacgcgatc aaggaccgcc ccaaggggat catcgccaac
      361 ccgaactgca ccaccatggc cgccatgccg gtgctgaagc cgctgcacca ggaggcgggc
      421 ctgaccgccc tggtcgccac cacctaccag gccgtgtccg gctcgggcct ggcgggcgtc
      481 gcggagctgg acggccaggt caaggccgtc gccgagaagg ccgccgagct cacccacgac
      541 ggtgaggccg tggcgtaccc ggagcccggc gtctacaagc gccccatcgc cttcaacgtg
      601 ctgccgctgg ccggctcgat cgtcgacgac ggctccttcg agacggacga ggagcagaag
      661 ctccgcaacg agtcccgcaa gatcctggag ctcccggacc tcaaggtctc cggcacgtgc
      721 gtgcgcgtcc cggtgttctc cggccactcc ctccaggtca acgcccggtt cgagcgcccg
      781 atcagcgtgg agcgcgccta cgagctgctg aaggacgccg agggcgtgga gctctccgag
      841 atccccaccc cgctccaggc ggccggcaag gacgcctcct acgtgggccg tatccgggtc
      901 gacgagacgg tcgagaacgg cctcgcgctg ttcctgtcca acgacaacct ccgcaagggc
      961 gcggcgctga acgcggtgca gatcgcggag ctggtggcgg aggagctcaa gggcgcctga
//