LOCUS AB073954 639 bp DNA linear VRT 06-JUN-2009 DEFINITION Gymnogobius urotaenia mitochondrial cytb gene for cytochrome b, partial cds, isolate:URBS-2. ACCESSION AB073954 VERSION AB073954.1 KEYWORDS . SOURCE mitochondrion Gymnogobius urotaenia ORGANISM Gymnogobius urotaenia Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Gobiaria; Gobiiformes; Gobioidei; Gobiidae; Gobionellinae; Gymnogobius. REFERENCE 1 (bases 1 to 639) AUTHORS Harada,S., Jeon,S., Kinoshita,I., Tanaka,M. and Nishida,M. TITLE Direct Submission JOURNAL Submitted (06-NOV-2001) to the DDBJ/EMBL/GenBank databases. Contact:Shigeo Harada Kyoto University, Division of Applied Bioscience, Graduate School of Agriculture; Kyoto University, Kitashirakawaoiwake-cho, Sakyo-ku, Kyoto, Kyoto 606-8502, Japan REFERENCE 2 AUTHORS Harada,S., Jeon,S.-R., Kinoshita,I., Tanaka,M. and Nishida,M. TITLE Phylogenetic relationships of four species of floating gobies (Gymnogobius) as inferred from partial mitochondrial cytochrome b gene sequences JOURNAL Ichthyol Res 49, 324-332 (2002) REFERENCE 3 AUTHORS Akihito, Sakamoto,K., Ikeda,Y. and Iwata,A. TITLE Gymnogobius urotaenia (ukigori) (in Japanese) JOURNAL (in) Nakabo,T.(Ed); Fishes of Japan with pictorial keys to the species (second edition):1197-1197; Tokai University Press,Tokyo (2000) COMMENT FEATURES Location/Qualifiers source 1..639 /citation=[3] /db_xref="taxon:178221" /isolate="URBS-2" /mol_type="genomic DNA" /note="Identical sequence is also seen in isolate:URBS-3" /organelle="mitochondrion" /organism="Gymnogobius urotaenia" CDS <1..>639 /codon_start=3 /gene="cytb" /product="cytochrome b" /protein_id="BAB91391.1" /transl_table=2 /translation="AVPYVGGTLVQWIWGGFSVDNATLTRFFAFHFLLPFVILAATLL HLLFLHETGSNNPAGLNSDADKIPFHPYFSYKDLLGFALMLLALASLALFSPNYLGDP DNFIPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALLASILVLLLVPLLHTSK QRSLTFRPVSQFLFWALVADVLILTWIGGMPVEHPYIIIGQIASFIYFSIFL" BASE COUNT 136 a 185 c 89 g 229 t ORIGIN 1 ctgcagtccc ctatgtaggt ggaactcttg tccaatgaat ttgaggaggt ttctcagtag 61 ataatgctac ccttacacga ttttttgcat ttcattttct tctccccttt gtgattcttg 121 ccgctaccct tctgcatctt cttttcttac atgaaactgg ctcaaataac ccagcaggat 181 taaactccga tgccgacaaa atcccctttc acccctactt ttcctataaa gatcttcttg 241 gctttgccct tatactccta gccctcgcct cccttgcact tttttcccct aattaccttg 301 gagatcctga caattttatc cctgcaaacc cgcttgttac tcctccccac attaagccag 361 agtgatattt cctttttgca tatgctattc ttcgttccat ccctaacaag ctaggaggag 421 ttctagccct ccttgcttcc attttggtac tactccttgt ccctcttcta catacgtcaa 481 aacaacgtag tttgaccttc cgcccagttt ctcaatttct cttctgagcc cttgtagcag 541 atgtacttat tctaacttga attggaggca tacctgttga acacccgtac attattattg 601 gacaaattgc atccttcatc tacttctcca tttttcttg //