LOCUS       AK290572                 888 bp    mRNA    linear   HUM 09-JAN-2008
DEFINITION  Homo sapiens cDNA FLJ78117 complete cds, highly similar to Homo
            sapiens interleukin 11 (IL11), mRNA.
ACCESSION   AK290572
VERSION     AK290572.1
KEYWORDS    FLI_CDNA; oligo capping.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 888)
  AUTHORS   Isogai,T. and Yamamoto,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases.
            Contact:Takao Isogai
            Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
            Chiyoda-ku, Tokyo 101-0044, Japan
            E-mail :flj-cdna@nifty.com
REFERENCE   2  
  AUTHORS   Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K.,
            Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y.,
            Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M.,
            Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T.
  TITLE     NEDO human cDNA sequencing project
  JOURNAL   Unpublished (2007)
COMMENT     Human cDNA sequencing project focused on splicing variants of mRNA
            in NEDO functional analysis of protein and research application
            project supported by Ministry of Economy, Trade and Industry,
            Japan; cDNA selection for complete cds sequencing: Reverse
            Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
            (Hitachi) and Japan Biological Informatics Consortium, Japan
            (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
            construction: Helix Research Institute supported by Japan Key
            Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
            Research Association for Biotechnology, Japan, Biotechnology
            Center, National Institute of Technology and Evaluation, Japan and
            HRI; cDNA mapping to human genome: Central Research Laboratory,
            Hitachi; evaluation and annotation: REPRORI.
FEATURES             Location/Qualifiers
     source          1..888
                     /cell_type="coronary artery smooth muscle cells (HCASMC)"
                     /clone="HCASM2001235"
                     /clone_lib="HCASM2"
                     /db_xref="H-InvDB:HIT000423369"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /note="primary culture, coronary artery smooth muscle
                     cells"
                     /organism="Homo sapiens"
     CDS             154..753
                     /codon_start=1
                     /note="highly similar to Homo sapiens interleukin 11
                     (IL11), mRNA"
                     /protein_id="BAF83261.1"
                     /transl_table=1
                     /translation="MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVL
                     LTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLL
                     SYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPP
                     LAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL"
BASE COUNT          131 a          337 c          269 g          151 t
ORIGIN      
        1 actgccgcgg ccctgctgct cagggcacat gcctcccctc cccaggccgc ggcccagctg
       61 accctcgggg ctcccccggc agcggacagg gaagggttaa aggcccccgg ctccctgccc
      121 cctgccctgg ggaacccctg gccctgtggg gacatgaact gtgtttgccg cctggtcctg
      181 gtcgtgctga gcctgtggcc agatacagct gtcgcccctg ggccaccacc tggcccccct
      241 cgagtttccc cagaccctcg ggccgagctg gacagcaccg tgctcctgac ccgctctctc
      301 ctggcggaca cgcggcagct ggctgcacag ctgagggaca aattcccagc tgacggggac
      361 cacaacctgg attccctgcc caccctggcc atgagtgcag gggcactggg agctctacag
      421 ctcccaggtg tgctgacaag gctgcgagcg gacctactgt cctacctgcg gcacgtgcag
      481 tggctgcgcc gggcaggtgg ctcttccctg aagaccctgg agcccgagct gggcaccctg
      541 caggcccgac tggaccggct gctgcgccgg ctgcagctcc tgatgtcccg cctggccctg
      601 ccccagccac ccccggaccc gccggcgccc ccgctggcgc ccccctcctc agcctggggg
      661 ggcatcaggg ccgcccacgc catcctgggg gggctgcacc tgacacttga ctgggccgtg
      721 aggggactgc tgctgctgaa gactcggctg tgacccgggg cccaaagcca ccaccgtcct
      781 tccaaagcca gatcttattt atttatttat ttcagtactg ggggcgaaac agccaggtga
      841 tccccccgcc attatctccc cctagttaga gacagtcctt ccgtgagg
//