LOCUS       Z75311                  4123 bp    mRNA    linear   HUM 24-SEP-2008
DEFINITION  H.sapiens mRNA for RAD50.
ACCESSION   Z75311
VERSION     Z75311.1
KEYWORDS    RAD50.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4123)
  AUTHORS   Offenberg,H.H.
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 4123)
  AUTHORS   Offenberg,H.H.
  JOURNAL   Submitted (10-JUL-1996) to the INSDC. Offenberg H.H., Agricultural
            University, Genetics, Dreyenlaan 2, Wageningen, 6703 HA The
            Netherlands
FEATURES             Location/Qualifiers
     source          1..4123
                     /db_xref="H-InvDB:HIT000328044"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /clone_lib="library HL1161a in lambda gt10 (Clontech)"
                     /tissue_type="testis"
                     /db_xref="taxon:9606"
     CDS             43..3999
                     /gene="RAD50"
                     /product="RAD50 homologue hsRAD50"
                     /function="DNA repair and recombindation protein"
                     /db_xref="GOA:Q92878"
                     /db_xref="H-InvDB:HIT000328044.14"
                     /db_xref="HGNC:HGNC:9816"
                     /db_xref="InterPro:IPR004584"
                     /db_xref="InterPro:IPR007517"
                     /db_xref="InterPro:IPR013134"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/Swiss-Prot:Q92878"
                     /protein_id="CAA99729.1"
                     /translation="MLIFSVRDMFAKMSILGVRSFGIEDKDKQIITFFSPLTILVGPN
                     GAGKTTIIECLKYICTGDFPPGTKGNTFVHDPKVAQETDVRAQIRLQFRDVNGELIAV
                     QRSMVCTQKSKKTEFKTLEGVITRTKHGEKVSLSSKCAEIDREMISSLGVSKAVLNNV
                     IFCHQEDSNWPLSEGKALKQKFDEIFSATRYIKALETLRQVRQTQGQKVEEYQMELKY
                     LKQYKEKACEIRDQITSKEAQLTSSKEIVKSYENELDPLKNRLKEIEHNLSKIMKLDN
                     EIKALDSRKKQMEKDNSELEEKMEKVFQGTDEQLNDLYHNHQRTVREKERKLVDCHRE
                     LEKLNKESRLLNQEKSELLVEQGRLQLQADRHQEHIRARDSLIQSLATQLELDGFERG
                     PFSERQIKNFHKLVRERQEGEAKTANQLMNDFAEKETLKQKQIDEIRDKKTGLGRIIE
                     LKSEILSKKQNELKNVKYELQQLEGSSDRILELDQELIKAERELSKAEKNSNVETLKM
                     EVISLQNEKADLDRTLRKLDQEMEQLNHHTTTRTQMEMLTKDKADKDEQIRKIKSRHS
                     DELTSLLGYFPNKKQLEDWLHSKSKEINQTRDRLAKLNKELASSEQNKNHINNELERK
                     EEQLSSYEDKLFDVCGSQDFESDLDRLKEEIEKSSKQRAMLAGATAVYSQFITQLTDE
                     NQSCCPVCQRVFQTEAELQEAISDLQSKLRLAPDKLKSTESELKKKEKRRDEMLGLAP
                     MRQSIIDLKEKEIPELRNKLQNVNRDIQRLKNDIEEQETLLGTIMPEEESAKVCLTDV
                     TIMERFQMELKDVERKIAQQAAKLQGIDLDRTVQQVNQEKQEKQHKLDTVSSKIELNR
                     KLIQDQQEQIQHLKSTTNELKSEKLQISTNLQRRQQLEEQTVELSTEVQSLYREIKDA
                     KEQVSPLETTLEKFQQEKEELINKKNTSNKIAQDKLNDIKEKVKNIHGYMKDIENHIQ
                     DGKDDYMKQKETELNKVIAQLSECEKHKEKINEDMRLMRQDIDTQKIQERWLQDNLTL
                     RKRNEELKEVEEEGKQHLKEMGQMQVLQMKSEHQKLEENIDNIKRNHNLALGRQKGYE
                     EEIIHFKKELREPQFRDAEEKYREMMIVMRTTELVNKDLDIYYKTLDQAIMKFHSMKM
                     EEINKIIRDLWRSTYRGQDIEYIEIRSDADENVSASDKRRNYNYRVVMLKGDTALDMR
                     GRCSAGQKVLASLIIRLALAETFCLNCGIIALDEPTTNLDRENIESLAHALVEIIKSR
                     SQQRNFQLLVITHDEDFVELLGRSEYVEKFYRIKKNIDQCSEIVKCSVSSLGFNVH"
BASE COUNT         1630 a          661 c          901 g          931 t
ORIGIN
        1 tgcggagttt tggaatagag gacaaagata agcacgccca gaatgctcat cttttcggtc
       61 cgggacatgt ttgcaaagat gagcattctg ggcgtgcgga gttttggaat agaggacaaa
      121 gataagcaaa ttatcacttt cttcagcccc cttacaattt tggttggacc caatggggcg
      181 ggaaagacga ccatcattga atgtctaaaa tatatttgta ctggagattt ccctcctgga
      241 accaaaggaa atacatttgt acacgatccc aaggttgctc aagaaacaga tgtgagagcc
      301 cagattcgtc tgcaatttcg tgatgtcaat ggagaactta tagctgtgca aagatctatg
      361 gtgtgtactc agaaaagcaa aaagacagaa tttaaaaccc tggaaggagt cattactaga
      421 acaaagcatg gtgaaaaggt cagtctgagc tctaagtgtg cagaaattga ccgagaaatg
      481 atcagttctc ttggggtttc caaggctgtg ctaaataatg tcattttctg tcatcaagaa
      541 gattctaatt ggcctttaag tgagggaaag gctttgaagc aaaagtttga tgagattttt
      601 tcagcaacaa gatacattaa agccctagaa acacttcggc aggtacgtca gacacaaggt
      661 cagaaagtag aagaatatca aatggaacta aaatatctga agcaatataa ggaaaaagct
      721 tgtgagattc gtgatcagat tacaagtaag gaagcccagt taacatcttc aaaggaaatt
      781 gtcaaatcct atgagaatga acttgatcca ttgaagaatc gtctaaaaga aattgaacat
      841 aatctctcta aaataatgaa acttgacaat gaaattaaag ccttggatag ccgaaagaag
      901 caaatggaga aagataatag tgaactggaa gagaaaatgg aaaaggtttt tcaagggact
      961 gatgagcaac taaatgactt atatcacaat caccagagaa cagtaaggga gaaagaaagg
     1021 aaattggtag actgtcatcg tgaactggaa aaactaaata aagaatctag gcttctcaat
     1081 caggaaaaat cagaactgct tgttgaacag ggtcgtctac agctgcaagc agatcgccat
     1141 caagaacata tccgagctag agattcatta attcagtctt tggcaacaca gctagaattg
     1201 gatggctttg agcgtggacc attcagtgaa agacagatta aaaattttca caaacttgtg
     1261 agagagagac aagaagggga agcaaaaact gccaaccaac tgatgaatga ctttgcagaa
     1321 aaagagactc tgaaacaaaa acagatagat gagataagag ataagaaaac tggactggga
     1381 agaataattg agttaaaatc agaaatccta agtaagaagc agaatgagct gaaaaatgtg
     1441 aagtatgaat tacagcagtt ggaaggatct tcagacagga ttcttgaact ggaccaggag
     1501 ctcataaaag ctgaacgtga gttaagcaag gctgagaaaa acagcaatgt agaaacctta
     1561 aaaatggaag taataagtct ccaaaatgaa aaagcagact tagacaggac cctgcgtaaa
     1621 cttgaccagg agatggagca gttaaaccat catacaacaa cacgtaccca aatggagatg
     1681 ctgaccaaag acaaagctga caaagatgaa caaatcagaa aaataaaatc taggcacagt
     1741 gatgaattaa cctcactgtt gggatatttt cccaacaaaa aacagcttga agactggcta
     1801 catagtaaat caaaagaaat taatcagacc agggacagac ttgccaaatt gaacaaggaa
     1861 ctagcttcat ctgagcagaa taaaaatcat ataaataatg aactagaaag aaaggaagag
     1921 cagttgtcca gttacgaaga caagctgttt gatgtttgtg gtagccagga ttttgaaagt
     1981 gatttagaca ggcttaaaga ggaaattgaa aaatcatcaa aacagcgagc catgctggct
     2041 ggagccacag cagtttactc ccagttcatt actcagctaa cagacgaaaa ccagtcatgt
     2101 tgccccgttt gtcagagagt ttttcagaca gaggctgagt tacaagaagc catcagtgat
     2161 ttgcagtcta aactgcgact tgctccagat aaactcaagt caacagaatc agagctaaaa
     2221 aaaaaggaaa agcggcgtga tgaaatgctg ggacttgcgc ccatgaggca aagcataatt
     2281 gatttgaagg agaaggaaat accagaatta agaaacaaac tgcagaatgt caatagagac
     2341 atacagcgcc taaagaacga catagaagaa caagaaacac tcttgggtac aataatgcct
     2401 gaagaagaaa gtgccaaagt atgcctgaca gatgttacaa ttatggagag gttccagatg
     2461 gaacttaaag atgttgaaag aaaaattgca caacaagcag ctaagctaca aggaatagac
     2521 ttagatcgaa ctgtccaaca agtcaaccag gagaaacaag agaaacagca caagttagac
     2581 acagtttcta gtaagattga attgaatcgt aagcttatac aggaccagca ggaacagatt
     2641 caacatctaa aaagtacaac aaatgagcta aaatctgaga aacttcagat atccactaat
     2701 ttgcaacgtc gtcagcaact ggaggagcag actgtggaat tatccactga agttcagtct
     2761 ttgtacagag agataaagga tgctaaagag caggtaagcc ctttggaaac aacattggaa
     2821 aagttccagc aagaaaaaga agaattaatc aacaaaaaaa atacaagcaa caaaatagca
     2881 caggataaac tgaatgatat taaagagaag gttaaaaata ttcatggcta tatgaaagac
     2941 attgagaatc atattcaaga tgggaaagac gactatatga agcaaaaaga aactgaactt
     3001 aataaagtaa tagctcaact aagtgaatgc gagaaacaca aagaaaagat aaatgaagat
     3061 atgagactca tgagacaaga tattgataca cagaagatac aagaaaggtg gctacaagat
     3121 aaccttactt taagaaaaag aaatgaggaa ctaaaagaag ttgaagaaga aggaaaacaa
     3181 catttgaagg aaatgggtca aatgcaggtt ttgcaaatga aaagtgaaca tcagaagttg
     3241 gaagagaaca tagacaatat aaaaagaaat cataatttgg cattagggcg acagaaaggt
     3301 tatgaagaag aaattattca ttttaagaaa gaacttcgag aaccacaatt tcgggatgct
     3361 gaggaaaagt atagagaaat gatgattgtt atgaggacaa cagaacttgt gaacaaggat
     3421 ctggatattt attataagac tcttgaccaa gcaataatga aatttcacag tatgaagatg
     3481 gaagaaatca ataaaattat acgtgacctg tggcgaagta cctatcgtgg acaagatatt
     3541 gaatacatag aaatacggtc tgatgccgat gaaaatgtat cagcttctga taaaaggcgg
     3601 aattataact accgagtggt gatgctgaag ggagacacag ccttggatat gcgaggacga
     3661 tgcagtgctg gacaaaaggt attagcctca ctcatcattc gcctggccct ggctgaaacg
     3721 ttctgcctca actgtggcat cattgccttg gatgagccaa caacaaatct tgaccgagaa
     3781 aacattgaat ctcttgcaca tgctctggtt gagataataa aaagtcgctc acagcagcgt
     3841 aacttccagc ttctggtaat cactcatgat gaagattttg tggagctttt aggacgttct
     3901 gaatatgtgg agaaattcta caggattaaa aagaacatcg atcagtgctc agagattgtg
     3961 aaatgcagtg ttagctccct gggattcaat gttcattaaa aatatccaag atttaaatgc
     4021 catagaaatg taggtcctca gaaagtgtat aataagaaac ttatttctca tatcaactta
     4081 gtcaataaga aaatatattc tttcaaagga aaaaaaaaaa aaa
//