LOCUS       Z70519                   899 bp    mRNA    linear   HUM 14-NOV-2006
DEFINITION  H.sapiens FAS/Apo 1 mRNA for FAS soluble protein (clone FAS
            Exo4Del).
ACCESSION   Z70519
VERSION     Z70519.1
KEYWORDS    FAS soluble protein; FAS/Apo 1 gene.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 899)
  AUTHORS   Papoff G., Cascino I., Eramo A., Starace G., Lynch D.H., Ruberti G.
  TITLE     An N-terminal domain shared by Fas/Apo-1 (CD95) soluble variants
            prevents cell death in vitro
  JOURNAL   J. Immunol. 156(12), 4622-4630(1996).
   PUBMED   8648105
REFERENCE   2  (bases 1 to 899)
  AUTHORS   Ruberti G.
  JOURNAL   Submitted (01-APR-1996) to the INSDC. Ruberti G., Cell Biology
            Institute, C.N.R., Immunology, viale C.Marx 43, Rome, Italy,
            I-00137
FEATURES             Location/Qualifiers
     source          1..899
                     /db_xref="H-InvDB:HIT000327886"
                     /organism="Homo sapiens"
                     /chromosome="10"
                     /isolate="LN"
                     /mol_type="mRNA"
                     /clone="FAS Exo4Del"
                     /cell_type="PHA-activated PBMC"
                     /db_xref="taxon:9606"
     CDS             1..450
                     /standard_name="FAS/Apo 1"
                     /product="FAS soluble protein"
                     /note="Alternative splicing variant of FAS gene missing
                     exon 4. Exons 5 and 6 translated in a different frame up
                     to a new stop codon at 448."
                     /db_xref="GOA:P25445"
                     /db_xref="H-InvDB:HIT000327886.13"
                     /db_xref="HGNC:HGNC:11920"
                     /db_xref="InterPro:IPR000488"
                     /db_xref="InterPro:IPR001368"
                     /db_xref="InterPro:IPR008063"
                     /db_xref="InterPro:IPR011029"
                     /db_xref="InterPro:IPR033998"
                     /db_xref="InterPro:IPR033999"
                     /db_xref="PDB:1BZI"
                     /db_xref="PDB:1DDF"
                     /db_xref="PDB:2NA7"
                     /db_xref="PDB:3EWT"
                     /db_xref="PDB:3EZQ"
                     /db_xref="PDB:3THM"
                     /db_xref="PDB:3TJE"
                     /db_xref="UniProtKB/Swiss-Prot:P25445"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /protein_id="CAA94430.1"
                     /translation="MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTV
                     ETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCR
                     RCRLCDEGHDVNMESSRNAHSPATPSAKRKDPDLTWGGFVFFFCQFH"
     exon            <1..30
                     /number=1
                     /experiment="experimental evidence, no additional details
                     recorded"
     exon            31..196
                     /number=2
                     /experiment="experimental evidence, no additional details
                     recorded"
     exon            197..334
                     /number=3
                     /experiment="experimental evidence, no additional details
                     recorded"
     exon            335..396
                     /number=5
                     /note="Translated in a different frame in this variant."
                     /experiment="experimental evidence, no additional details
                     recorded"
     exon            397..459
                     /number=6
                     /note="Translated in a different frame in this variant up
                     to a new stop codon at 448."
                     /experiment="experimental evidence, no additional details
                     recorded"
     exon            460..542
                     /number=7
                     /note="Not translated in this variant."
                     /experiment="experimental evidence, no additional details
                     recorded"
     exon            543..567
                     /number=8
                     /note="Not translated in this variant."
                     /experiment="experimental evidence, no additional details
                     recorded"
     exon            568..>899
                     /number=9
                     /note="Not translated in this variant."
                     /experiment="experimental evidence, no additional details
                     recorded"
BASE COUNT          307 a          179 c          197 g          216 t
ORIGIN      
        1 atgctgggca tctggaccct cctacctctg gttcttacgt ctgttgctag attatcgtcc
       61 aaaagtgtta atgcccaagt gactgacatc aactccaagg gattggaatt gaggaagact
      121 gttactacag ttgagactca gaacttggaa ggcctgcatc atgatggcca attctgccat
      181 aagccctgtc ctccaggtga aaggaaagct agggactgca cagtcaatgg ggatgaacca
      241 gactgcgtgc cctgccaaga agggaaggag tacacagaca aagcccattt ttcttccaaa
      301 tgcagaagat gtagattgtg tgatgaagga catgatgtga acatggaatc atcaaggaat
      361 gcacactcac cagcaacacc aagtgcaaag aggaaggatc cagatctaac ttggggtggc
      421 tttgtcttct tcttttgcca attccactaa ttgtttgggt gaagagaaag gaagtacaga
      481 aaacatgcag aaagcacaga aaggaaaacc aaggttctca tgaatctcca accttaaatc
      541 ctgaaacagt ggcaataaat ttatctgatg ttgacttgag taaatatatc accactattg
      601 ctggagtcat gacactaagt caagttaaag gctttgttcg aaagaatggt gtcaatgaag
      661 ccaaaataga tgagatcaag aatgacaatg tccaagacac agcagaacag aaagttcaac
      721 tgcttcgtaa ttggcatcaa cttcatggaa agaaagaagc gtatgacaca ttgattaaag
      781 atctcaaaaa agccaatctt tgtactcttg cagagaaaat tcagactatc atcctcaagg
      841 acattactag tgactcagaa aattcaaact tcagaaatga aatccaaagc ttggtctag
//