LOCUS       Y11997                  3045 bp    mRNA    linear   HUM 11-MAY-2001
DEFINITION  H.sapiens mRNA for A-kinase anchoring protein AKAP95.
ACCESSION   Y11997
VERSION     Y11997.1
KEYWORDS    akap95 gene; kinase A anchor protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3045)
  AUTHORS   Tasken K.
  JOURNAL   Submitted (21-MAR-1997) to the INSDC. K. Tasken, University of
            Oslo, Institute of Medical Biochemistry, P.O. Box 1112, Blindern,
            N-0317 Oslo, NORWAY
REFERENCE   2  (bases 1 to 3045)
  AUTHORS   Eide T., Coglan V., Orstavik S., Holsve C., Solberg R.,
            Skalhegg B.S., Lamb N.J., Langeberg L., Fernandez A., Scott J.D.,
            Jahnsen T., Tasken K.
  TITLE     Molecular cloning, chromosomal localization, and cell
            cycle-dependent subcellular distribution of the A-kinase anchoring
            protein, AKAP95
  JOURNAL   Exp. Cell Res. 238(2), 305-316(1998).
   PUBMED   9473338
FEATURES             Location/Qualifiers
     source          1..3045
                     /db_xref="H-InvDB:HIT000325684"
                     /organism="Homo sapiens"
                     /chromosome="19"
                     /map="p13.1-q12"
                     /mol_type="mRNA"
                     /clone_lib="Clontech Lambda gt11, cat. no. HL1128b"
                     /clone_lib="Stratagene Lambda ZAP express, cat no. 939202"
                     /clone_lib="Clonetech Maraton RACE-ready cDNA, cat. no.
                     7401-1"
                     /clone="1"
                     /clone="13.3"
                     /clone="4.1"
                     /db_xref="taxon:9606"
     5'UTR           <1..61
                     /gene="akap95"
     CDS             62..2140
                     /gene="akap95"
                     /product="A-kinase anchoring protein 95"
                     /db_xref="GOA:O43823"
                     /db_xref="H-InvDB:HIT000325684.14"
                     /db_xref="HGNC:HGNC:378"
                     /db_xref="InterPro:IPR007071"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/Swiss-Prot:O43823"
                     /protein_id="CAA72722.1"
                     /translation="MDQGYGGYGAWSAGPANTQGAYGTGVASWQGYENYNYYGAQNTS
                     VTTGATYSYGPASWEAAKANDGGLAAGAPAMHMASYGPEPCTDNSDSLIAKINQRLDM
                     MSKEGGRGGSGGGGEGIQDRESSFRFQPFESYDSRPCLPEHNPYRPSYSYDYEFDLGS
                     DRNGSFGGQYSECRDPARERGSLDGFMRGRGQGRFQDRSNPGTFMRSDPFVPPAASSE
                     PLSTPWNELNYVGGRGLGGPSPSRPPPSLFSQSMAPDYGVMGMQGAGGYDSTMPYGCG
                     RSQPRMRDRDRPKRRGFDRFGPDGTGRKRKQFQLYEEPDTKLARVDSEGDFSENDDAA
                     GDFRSGDEEFKGEDELCDSGRQRGEKEDEDEDVKKRREKQRRRDRTRDRAADRIQFAC
                     SVCKFRSFDDEEIQKHLQSKFHKETLRFISTKLPDKTVEFLQEYIVNRNKKIEKRRQE
                     LMEKETAKPKPDPFKGIGQEHFFKKIEAAHCLACDMLIPAQPQLLQRHLHSVDHNHNR
                     RLAAEQFKKTSLHVAKSVLNNRHIVKMLEKYLKGEDPFTSETVDPEMEGDDNLGGEDK
                     KETPEEVAADVLAEVITAAVRAVDGEGAPAPESSGEPAEDEGPTDTAEAGSDPQAEQL
                     LEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEAESAQTRVAPAPAAADAEVEQTD
                     AESKDAVPTE"
     3'UTR           2141..>3045
                     /gene="akap95"
BASE COUNT          772 a          785 c          866 g          622 t
ORIGIN      
        1 tgaacgcatg cgtgctgtgg tcgcctagta aacggggctg ctggtgggcc gcgtcgaaga
       61 catggaccag ggctacggag gctacggggc gtggagtgct ggacctgcca acacccaggg
      121 tgcatatgga actggtgtgg ccagctggca aggttatgaa aactacaatt actatggcgc
      181 ccagaacacc agtgtcacca caggcgcaac ctacagctac ggcccagcct cgtgggaggc
      241 cgccaaggcc aatgatggcg gcctggcggc cggggcccct gccatgcaca tggcctctta
      301 cggcccagag ccatgcaccg acaattccga ctccctcatt gccaagatca accagcgttt
      361 ggacatgatg tccaaggaag gaggcagggg cgggagcggc ggcggtgggg agggcataca
      421 ggaccgggag agctccttcc gcttccagcc gttcgagtcc tatgactcca ggccctgcct
      481 gccggagcac aacccctacc gccccagcta cagctacgac tatgagttcg acctggggtc
      541 cgaccgcaat ggcagctttg gggggcagta cagtgaatgc cgagacccag cccgggagcg
      601 gggctccctt gatggcttca tgcggggccg gggccagggc cgcttccagg accggagcaa
      661 ccctggcacc ttcatgcgca gcgacccctt cgtgcccccc gctgcgtcct ctgagcccct
      721 gtccacgccc tggaacgagc tgaactacgt gggtggacgg ggcctgggag ggccctcccc
      781 cagccggcca cctccgtccc tcttctccca gtccatggct cccgactacg gcgtgatggg
      841 catgcagggg gcgggcggct atgacagcac catgccctac ggatgtggcc gctcgcagcc
      901 tcggatgcgg gatcgggatc ggcccaagag gagagggttt gaccgcttcg gaccagatgg
      961 cacgggcagg aaacggaagc agttccaact ttacgaggag ccagacacca aactggcccg
     1021 ggttgacagt gaaggagatt tctccgaaaa tgatgacgca gctggtgact tccgctcagg
     1081 agatgaagaa ttcaagggtg aggatgaact ctgcgactct gggaggcaaa gaggagagaa
     1141 ggaggacgag gacgaggatg tgaagaagag aagggaaaag caaaggagaa gagacaggac
     1201 gcgggaccgt gcagccgaca gaattcagtt tgcctgttct gtatgcaagt tccgtagctt
     1261 tgatgacgaa gagatccaga agcatctgca aagcaaattt cacaaagaga ccctgcggtt
     1321 cataagcacc aagctgcccg acaagaccgt ggagttcctc caggaataca ttgtaaacag
     1381 aaataagaaa attgagaagc ggcgtcagga attgatggag aaagaaaccg caaaaccaaa
     1441 accagatcct ttcaaaggga ttggccagga gcacttcttc aagaagatcg aggctgctca
     1501 ctgcctggcc tgcgacatgc taattcctgc acagccgcag ctcctccagc ggcacctgca
     1561 ctccgtggac cacaatcaca accgcaggtt ggctgctgaa cagttcaaga aaaccagtct
     1621 ccatgtggct aagagtgttt tgaacaacag acatatagtg aagatgctgg aaaaatacct
     1681 caagggtgag gaccctttca ccagtgaaac tgttgatcca gaaatggaag gagatgacaa
     1741 tttaggaggt gaggataaga aagagacacc tgaggaggtg gccgcggacg tcttagcaga
     1801 ggtgattaca gcagcagtga gggccgtaga tggggaagga gcgcccgctc cagagagcag
     1861 cggggagccg gctgaggacg aaggccccac ggacacagcg gaggccggta gtgatcctca
     1921 agccgaacag ctgctggaag agcaggtgcc ctgtggaacg gcacatgaga agggcgtccc
     1981 caaggccaga agtgaggctg cagaggctgg aaatggcgcc gagacaatgg cagcagaggc
     2041 agaaagtgcc caaaccagag ttgctcctgc cccagctgcc gcggatgctg aagtggaaca
     2101 aactgatgca gagtctaaag acgctgttcc cacagaatga tgctcatttc cctgttccag
     2161 ggaaggcgtt gggatgatgg atgcgttggt ctttctccct tggtttgtaa gcagtacaag
     2221 ggcgtgtgct cccagaatat gctgtaatct aattttggtg aagagaccca gcgtttcctc
     2281 ctgagcagtg cctctcacgg cttgtctcat gcagtcgtgt ggcttcttgc ccaggtttca
     2341 aagctgaagt acattgtcct tagcggctgt aacatgtctc ttgacagtag tgcacttgga
     2401 ataataaagg ttgggtgatt atatcttgat gatacattac ttgttcaata cagccactga
     2461 tggaatgctt ccttttttat ttttttcctt aatttttttt tttatttggt tgggaacagc
     2521 tgaatactag gaatatatct tgctctatag aggatttttt tttgtatgtt tcaagcttca
     2581 gcctttaacc tatacctttg tagtgcacca tatggtgtgt gactttcaca ggacttcgca
     2641 gcacctggtt cacatgtggc actgaccgcg tcacatccac gcactcccaa aggccagaag
     2701 tatctgaccg acctacgcca ctggaaacac acccaccgca acctcaagaa ccagactgtg
     2761 cagagggcat tgcgtcccaa tctttagtcc ttgctgaatc agttctctaa tattttacct
     2821 catttgtgtt ccacctctag attacttcag gtttttttcc tttaaaatta gttactacca
     2881 ctcaaatgta tttacaaaga gaatttggcc aggcacggtg atgcatacct ataatcccag
     2941 cacttgggga ggccgtggtg agaggatagc ttaagcccag gagttcaaga ccaacctgga
     3001 caacatagca agaccccatc tcttaaaaaa aaaaaaaaaa aaaaa
//