LOCUS       Y10488                  1259 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  H.sapiens mRNA for stress activated protein kinase-4.
ACCESSION   Y10488
VERSION     Y10488.1
KEYWORDS    sapk4 gene; stress activated protein kinase.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1
  AUTHORS   Goedert M., Cuenda A., Craxton M., Jakes R., Cohen P.
  TITLE     Activation of the novel stress-activated protein kinase SAPK4 by
            cytokines and cellular stresses is mediated by SKK3 (MKK6);
            comparison of its substrate specificity with that of other SAP
            kinases
  JOURNAL   EMBO J. 16(12), 3563-3571(1997).
   PUBMED   9218798
REFERENCE   2  (bases 1 to 1259)
  AUTHORS   Goedert M.
  JOURNAL   Submitted (13-JAN-1997) to the INSDC. M. Goedert, Medical Research
            Council, Laboratory of Molecular Biology, Hills Road, Cambridge,
            CB2 2QH, UK
FEATURES             Location/Qualifiers
     source          1..1259
                     /db_xref="H-InvDB:HIT000325590"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /dev_stage="adult"
                     /clone="hSAPK412"
                     /tissue_type="pituitary"
                     /db_xref="taxon:9606"
     CDS             23..1120
                     /gene="SAPK4"
                     /product="stress-activated protein kinase-4"
                     /db_xref="GOA:O15264"
                     /db_xref="H-InvDB:HIT000325590.13"
                     /db_xref="HGNC:HGNC:6875"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008352"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="PDB:3COI"
                     /db_xref="PDB:4EYJ"
                     /db_xref="PDB:4EYM"
                     /db_xref="PDB:4MYG"
                     /db_xref="PDB:4YNO"
                     /db_xref="UniProtKB/Swiss-Prot:O15264"
                     /protein_id="CAA71512.1"
                     /translation="MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAID
                     KRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYD
                     FYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNE
                     DCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLT
                     GKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPR
                     ASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLT
                     VDEWKQHIYKEIVNFSPIARKDSRRRSGMKL"
BASE COUNT          296 a          359 c          367 g          237 t
ORIGIN      
        1 ccgccgagat cgggtgcccg ggatgagcct catccggaaa aagggcttct acaagcagga
       61 cgtcaacaag accgcctggg agctgcccaa gacctacgtg tccccgacgc acgtcggcag
      121 cggggcctat ggctccgtgt gctcggccat cgacaagcgg tcaggggaga aggtggccat
      181 caagaagctg agccgaccct ttcagtccga gatcttcgcc aagcgcgcct accgggagct
      241 gctgctgctg aagcacatgc agcatgagaa cgtcattggg ctcctggatg tcttcacccc
      301 agcctcctcc ctgcgcaact tctatgactt ctacctggtg atgcccttca tgcagacgga
      361 tctgcagaag atcatgggga tggagttcag tgaggagaag atccagtacc tggtgtatca
      421 gatgctcaaa ggccttaagt acatccactc tgctggggtc gtgcacaggg acctgaagcc
      481 aggcaacctg gctgtgaatg aggactgtga actgaagatt ctggattttg ggctggcgcg
      541 acatgcagac gccgagatga ctggctacgt ggtgacccgc tggtaccgag cccccgaggt
      601 gatcctcagc tggatgcact acaaccagac agtggacatc tggtctgtgg gctgtatcat
      661 ggcagagatg ctgacaggga aaactctgtt caaggggaaa gattacctgg accagctgac
      721 ccagatcctg aaagtgaccg gggtgcctgg cacggagttt gtgcagaagc tgaacgacaa
      781 agcggccaaa tcctacatcc agtccctgcc acagaccccc aggaaggatt tcactcagct
      841 gttcccacgg gccagccccc aggctgcgga cctgctggag aagatgctgg agctagacgt
      901 ggacaagcgc ctgacggccg cgcaggccct cacccatccc ttctttgaac ccttccggga
      961 ccctgaggaa gagacggagg cccagcagcc gtttgatgat tccttagaac acgagaaact
     1021 cacagtggat gaatggaagc agcacatcta caaggagatt gtgaacttca gccccattgc
     1081 ccggaaggac tcacggcgcc ggagtggcat gaagctgtag ggactcatct tgcatggcac
     1141 cgccggccag acactgccca aggaccagta tttgtcacta ccaaactcag cccttcttgg
     1201 aatacagcct ttcaagcaga ggacagaagg gtccttctcc ttatgtggga aatgggcct
//