LOCUS       Y00978                  2583 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Human mRNA for dihydrolipoamide acetyltransferase (PDC-E2) (EC
            2.3.1.12).
ACCESSION   Y00978 X13969
VERSION     Y00978.1
KEYWORDS    dihydrolipoamide acetyltransferase.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2583)
  AUTHORS   Patel,M.S.
  JOURNAL   Submitted (16-FEB-1989) to the INSDC. Patel M.S., Case Western
            Reserve University, Dept. of Biochemistry, School of Medicine, 2119
            Abington Road, Cleveland, Ohio USA 44106.
REFERENCE   2  (bases 1 to 2583)
  AUTHORS   Thekkumkara,T.J., Ho,L., Wexler,I.D., Pon,G., Liu,T. and Patel,M.S.
  TITLE     Nucleotide sequence of a cDNA for the dihydrolipoamide
            acetyltransferase component of human pyruvate dehydrogenase complex
  JOURNAL   FEBS Lett. 240(1-2), 45-48(1988).
   PUBMED   3191998
COMMENT     The sequence overlaps with that reported by Coppel et. al. in
            Proc. Natl. Acad. Sci. USA 85:7317-7321(1988) J03866.
            
            Data kindly reviewed (29th March 1989) by Patel M.S.
FEATURES             Location/Qualifiers
     source          1..2583
                     /db_xref="H-InvDB:HIT000325334"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /clone_lib="lambda gt11"
                     /tissue_type="liver."
                     /db_xref="taxon:9606"
     CDS             <1..1848
                     /codon_start=1
                     /product="PDC-E2 precursor (AA -54 to 561)"
                     /db_xref="GOA:P10515"
                     /db_xref="H-InvDB:HIT000325334.13"
                     /db_xref="HGNC:HGNC:2896"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001078"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR004167"
                     /db_xref="InterPro:IPR006257"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR023213"
                     /db_xref="PDB:1FYC"
                     /db_xref="PDB:1Y8N"
                     /db_xref="PDB:1Y8O"
                     /db_xref="PDB:1Y8P"
                     /db_xref="PDB:2DNE"
                     /db_xref="PDB:2PNR"
                     /db_xref="PDB:2Q8I"
                     /db_xref="PDB:3B8K"
                     /db_xref="PDB:3CRK"
                     /db_xref="PDB:3CRL"
                     /db_xref="UniProtKB/Swiss-Prot:P10515"
                     /protein_id="CAA68787.1"
                     /translation="RVTSRSGPAPARRNSVTTGYGGVRALCGWTPSSGATPRNRLLLQ
                     LLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIARWKKKEGDKINEGDLIAEVETDKAT
                     VGFESLEECYMAKILVAEGTRDVPIGAIICITVGKPEDIEAFKNYTLDSSAAPTPQAA
                     PAPTPAATASPPTPSAQAPGSSYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGD
                     LLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYRP
                     TEVTDLKPQVPPPTPPPVAAVPPTPQPLAPTPSAPCPATPAGPKGRVFVSPLAKKLAV
                     EKGIDLTQVKGTGPDGRITKKDIDSFVPSKVAPAPAAVVPPTGPGMAPVPTGVFTDIP
                     ISNIRRVIAQRLMQSKQTIPHYYLSIDVNMGEVLLVRKELNKILEGRSKISVNDFIIK
                     ASALACLKVPEANSSWMDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGVETIAND
                     VVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAIGASEDKLV
                     PADNEKGFDVASMMSVTLSCDHRVVDGAVGAQWLAEFRKYLEKPITMLL"
     transit_peptide <1..162
                     /codon_start=1
                     /note="leader peptide (AA -54 to -1)"
     mat_peptide     163..1845
                     /product="mature PDC-E2 (AA 1-561)"
BASE COUNT          742 a          562 c          564 g          715 t
ORIGIN
        1 cgagtgacct cgcgatctgg cccggctccc gctcgtcgca acagcgtgac tacagggtat
       61 ggcggggtcc gggcactgtg cggctggacc cccagttctg gggccacgcc gcggaaccgc
      121 ttactgctgc agcttttggg gtcgcccggc cgccgctatt acagtcttcc cccgcatcag
      181 aaggttccat tgccttctct ttcccccaca atgcaggcag gcaccatagc ccgttggaaa
      241 aaaaaagagg gggacaaaat caatgaaggt gacctaattg cagaggttga aactgataaa
      301 gccactgttg gatttgagag cctggaggag tgttatatgg caaagatact tgttgctgaa
      361 ggtaccaggg atgttcccat cggagcgatc atctgtatca cagttggcaa gcctgaggat
      421 attgaggcct ttaaaaatta tacactggat tcctcagcag cacctacccc acaagcggcc
      481 ccagcaccaa cccctgctgc cactgcttcg ccacctacac cttctgctca ggctcctggt
      541 agctcatatc cccctcacat gcaggtactt cttcctgccc tctctcccac catgaccatg
      601 ggcacagttc agagatggga aaaaaaagtg ggtgagaagc taagtgaagg agacttactg
      661 gcagagatag aaactgacaa agccactata ggttttgaag tacaggaaga aggttatctg
      721 gcaaaaatcc tggtccctga aggcacaaga gatgtccctc taggaacccc actctgtatc
      781 attgtagaaa aagaggcaga tatatcagca tttgctgact ataggccaac cgaagtaaca
      841 gatttaaaac cacaagtgcc accacctacc ccacccccgg tggccgctgt tcctccaact
      901 ccccagcctt tagctcctac accttcagca ccctgcccag ctactcctgc tggaccaaag
      961 ggaagggtgt ttgttagccc tcttgcaaag aagttggcag tagagaaagg gattgatctt
     1021 acacaagtaa aagggacagg accagatggt agaatcacca agaaggatat cgactctttt
     1081 gtgcctagta aagttgctcc tgctccggca gctgttgtgc ctcccacagg tcctggaatg
     1141 gcaccagttc ctacaggtgt cttcacagat atcccaatca gcaacattcg tcgggttatt
     1201 gcacagcgat taatgcaatc aaagcaaacc atacctcatt attacctttc tatcgatgta
     1261 aatatgggag aagttttgtt ggtacggaaa gaacttaata agatattaga agggagaagc
     1321 aaaatttctg tcaatgactt catcataaaa gcttcagctt tggcatgttt aaaagttccc
     1381 gaagcaaatt cttcttggat ggacacagtt ataagacaaa atcatgttgt tgatgtcagt
     1441 gttgcggtca gtactcctgc aggactcatc acacctattg tgtttaatgc acatataaaa
     1501 ggagtggaaa ccattgctaa tgatgttgtt tctttagcaa ccaaagcaag agagggtaaa
     1561 ctacagccac atgaattcca gggtggcact tttacgatct ccaatttagg aatgtttgga
     1621 attaagaatt tctctgctat tattaaccca cctcaagcat gtattttggc aattggtgct
     1681 tcagaggata aactggtccc tgcagataat gaaaaagggt ttgatgtggc tagcatgatg
     1741 tctgttacac tcagttgtga tcaccgggtg gtggatggag cagttggagc ccagtggctt
     1801 gctgagttta gaaagtacct tgaaaaacct atcactatgt tgttgtaact aactcaagaa
     1861 tttctaaact ctcccaggtc acactgattc attcttaaca agatatttat atgttattaa
     1921 acaggtggtt gctttttatt ttaaccagtt atttttatta ttgagtctgc tcagataagt
     1981 tatttataat gggcattact gaatttttaa aatgccgatt acacccaaat attgtgcaca
     2041 tttaataatc agacaccaga tttttagctc tgtactccta attaagggac atgtatgtgg
     2101 ccttgcctag ccctttggtg ataagtactt cctctaggaa atgtacgata ggtagaattg
     2161 tggttcccta aagacaagta cataaaggtg accctgatga aaccttgaag ttctgaaatt
     2221 taactgccta aaatgttctc cttagatgtg agagaaagag aaatcagaaa aattaattct
     2281 cttgggggaa gggcttgaat tgaagcttta ctttagaatt tagccctggt ttgaaatttt
     2341 ccattacatg atcttggttt atcatcgatg ggaagggtag aaaacttcaa ggaaaataag
     2401 tgaaatttta aaagtcagca ttttcttaga cctcttcagc tgattgttta tttttctatg
     2461 aattctgtac tcaaaattac acatttgttt aaataaatat ccacacaaat tctcagttac
     2521 atcaagtagc tggtttatat ttagattatc tcaagtaggg gggaataacc atgtgtagga
     2581 att
//