LOCUS       Y00345                  2848 bp    mRNA    linear   HUM 12-SEP-1993
DEFINITION  Human mRNA for polyA binding protein.
ACCESSION   Y00345
VERSION     Y00345.1
KEYWORDS    polyA binding protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2848)
  AUTHORS   Grange T., Pictet R.
  JOURNAL   Submitted (11-JUN-1987) to the INSDC. Thierry Grange and R. Pictet,
            CNRS, Institut J.Monod, Universite Paris 7 Tour 43, 2 place
            Jussieu, Paris 75005.
REFERENCE   2
  AUTHORS   Grange T., Martin de Sa C., Oddos J., Pictet R.
  TITLE     Human mRNA polyadenylate binding protein: evolutionary conservation
            of a nucleic acid binding motif
  JOURNAL   Nucleic Acids Res. 15(12), 4771-4787(1987).
   PUBMED   2885805
COMMENT     Data kindly reviewed (06-JUN-1987) by Pictet R.
FEATURES             Location/Qualifiers
     source          1..2848
                     /db_xref="H-InvDB:HIT000325282"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /cell_line="Melanoma cell (Bowes)"
                     /db_xref="taxon:9606"
     misc_feature    70..131
                     /note="A rich sequence"
     CDS             503..2404
                     /note="polyA binding protein (AA 1-633)"
                     /db_xref="GOA:P11940"
                     /db_xref="H-InvDB:HIT000325282.13"
                     /db_xref="HGNC:HGNC:8554"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR002004"
                     /db_xref="InterPro:IPR006515"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="PDB:1CVJ"
                     /db_xref="PDB:1G9L"
                     /db_xref="PDB:1JGN"
                     /db_xref="PDB:1JH4"
                     /db_xref="PDB:2K8G"
                     /db_xref="PDB:2RQG"
                     /db_xref="PDB:2RQH"
                     /db_xref="PDB:2X04"
                     /db_xref="PDB:3KTP"
                     /db_xref="PDB:3KTR"
                     /db_xref="PDB:3KUI"
                     /db_xref="PDB:3KUJ"
                     /db_xref="PDB:3KUR"
                     /db_xref="PDB:3KUS"
                     /db_xref="PDB:3KUT"
                     /db_xref="PDB:3PKN"
                     /db_xref="PDB:3PTH"
                     /db_xref="PDB:4F02"
                     /db_xref="PDB:4F25"
                     /db_xref="PDB:4F26"
                     /db_xref="PDB:5DX1"
                     /db_xref="PDB:5DX8"
                     /db_xref="PDB:5DXA"
                     /db_xref="UniProtKB/Swiss-Prot:P11940"
                     /protein_id="CAA68428.1"
                     /translation="MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCR
                     DMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIF
                     IKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNG
                     MLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGPALSVK
                     VMTDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRK
                     FEQMKQDRITRYQGVNLYVKNLDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGF
                     VCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNP
                     VINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQVAQLRPSPRWTAQGARPHPFQNMPGA
                     IRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQY
                     KYAAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPL
                     IQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAV
                     NSATGVPTV"
     misc_feature    542..1627
                     /note="4x repeated motif"
     misc_feature    1670..2173
                     /note="proline rich domain"
     misc_feature    2508..2513
                     /note="alternate polyA signal"
     misc_feature    2512..2517
                     /note="alternate polyA signal"
     misc_feature    2827..2832
                     /note="put. polyA signal"
     polyA_site      2848..2848
                     /note="polyA site"
BASE COUNT          841 a          694 c          621 g          692 t
ORIGIN      
        1 ccttctcccc ggcggttagt gctgagagtg cggagtgtgt gctccgggct cggaacacac
       61 atttattatt aaaaaatcca aaaaaaatct aaaaaaatct tttaaaaaac cccaaaaaaa
      121 tttacaaaaa atccgcgtct cccccgccgg agacttttat tttttttctt cctcttttat
      181 aaaataaccc ggtgaagcag ccgagaccga cccgcccgcc cgcggccccg cagcagctcc
      241 aagaaggaac caagagaccg aggccttccc gctgcccgga cccgacaccg ccaccctcgc
      301 tccccgccgg cagccggcag ccagcggcag tggatcgacc ccgttctgcg gccgttgagt
      361 agttttcaat tccggttgat ttttgtccct ctgcgcttgc tccccgctcc cctccccccg
      421 gctccggccc ccagccccgg cactcgctct cctcctctca cggaaaggtc gcggcctgtg
      481 ccctgcgggc agccgtgccg agatgaaccc cagtgccccc agctacccca tggcctcgct
      541 ctacgtgggg gacctccacc ccgacgtgac cgaggcgatg ctctacgaga agttcagccc
      601 ggccgggccc atcctctcca tccgggtctg cagggacatg atcacccgcc gctccttggg
      661 ctacgcgtat gtgaacttcc agcagccggc ggacgcggag cgtgctttgg acaccatgaa
      721 ttttgatgtt ataaagggca agccagtacg catcatgtgg tctcagcgtg atccatcact
      781 tcgcaaaagt ggagtaggca acatattcat taaaaatctg gacaaatcca ttgataataa
      841 agcactgtat gatacatttt ctgcttttgg taacatcctt tcatgtaagg tggtttgtga
      901 tgaaaatggt tccaagggct acggatttgt acactttgag acgcaggaag cagctgaaag
      961 agctattgaa aaaatgaatg gaatgctcct aaatgatcgc aaagtatttg ttggacgatt
     1021 taagtctcgt aaagaacgag aagctgaact tggagctagg gcaaaagaat tcaccaatgt
     1081 ttacatcaag aattttggag aagacatgga tgatgagcgc cttaaggatc tctttgggcc
     1141 tgccttaagt gtgaaagtaa tgactgatga aagtggaaaa tccaaaggat ttggatttgt
     1201 aagctttgaa aggcatgaag atgcacagaa agctgtggat gagatgaacg gaaaggagct
     1261 caatggaaaa caaatttatg ttggtcgagc tcagaaaaag gtggaacggc agacggaact
     1321 taagcgcaaa tttgaacaga tgaaacaaga taggatcacc agataccagg gtgttaatct
     1381 ttatgtgaaa aatcttgatg atggtattga tgatgaacgt ctccggaaag agttttctcc
     1441 atttggtaca atcactagtg caaaggttat gatggagggt ggtcgcagca aagggtttgg
     1501 ttttgtatgt ttctcctccc cagaagaagc cactaaagca gttacagaaa tgaacggtag
     1561 aattgtggcc acaaagccat tgtatgtagc tttagctcag cgcaaagaag agcgccaggc
     1621 tcacctcact aaccagtata tgcagagaat ggcaagtgta cgagctgttc ccaaccctgt
     1681 aatcaacccc taccagccag cacctccttc aggttacttc atggcagcta tcccacagac
     1741 tcagaaccgt gctgcatact atcctcctag ccaagttgct caactaagac caagtcctcg
     1801 ctggactgct cagggtgcca gacctcatcc attccaaaat atgcccggtg ctatccgccc
     1861 agctgctcct agaccaccat ttagtactat gagaccagct tcttcacagg ttccacgagt
     1921 catgtcaaca cagcgtgttg ctaacacatc aacacagaca atgggtccac gtcctgcagc
     1981 tgcagccgct gcagctactc ctgctgtccg caccgttcca cagtataaat atgctgcagg
     2041 agttcgcaat cctcagcaac atcttaatgc acagccacaa gttacaatgc aacagcctgc
     2101 tgttcatgta caaggtcagg aacctttgac tgcttccatg ttggcatctg cccctcctca
     2161 agagcaaaag caaatgttgg gtgaacggct gtttcctctt attcaagcca tgcaccctac
     2221 tcttgctggt aaaatcactg gcatgttgtt ggagattgat aattcagaac ttcttcatat
     2281 gctcgagtct ccagagtcac tccgttctaa ggttgatgaa gctgtagctg tactacaagc
     2341 ccaccaagct aaagaggctg cccagaaagc agttaacagt gccaccggtg ttccaactgt
     2401 ttaaaattga tcagggacca tgaaaagaaa cttgtgcttc accgaagaaa aatatctaaa
     2461 catcgaaaaa cttaaatatt atggaaaaaa aacattgcaa aatataaaat aaataaaaaa
     2521 aggaaaggaa actttgaacc ttatgtaccg agcaaatgcc aggtctagca aacataatgc
     2581 tagtcctaga ttacttattg atttaaaaac aaaaaaacac aaaaaatagt aaaatataaa
     2641 aacaaattaa tgttttatag accctgggaa aaagaatttt cagcaaagta caaaaattta
     2701 aagcattcct ttctttaatt ttgtaattct ttactgtgga atagctcaga atgtcagttc
     2761 tgttttaagt aacagaattg ataactgagc aaggaaacgt aatttggatt ataaaattct
     2821 tgctttaata aaaattcctt aaacagtg
//