LOCUS       X97674                  6156 bp    mRNA    linear   HUM 21-OCT-2008
DEFINITION  H.sapiens mRNA for transcriptional intermediary factor 2.
ACCESSION   X97674
VERSION     X97674.1
KEYWORDS    alternatively spliced; nuclear receptor coactivator; TIF2 gene;
            transcriptional mediator.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1
  AUTHORS   Voegel,J.J., Heine,M.J.S., Zechel,C., Chambon,P. and  Gronemeyer,H.
  TITLE     TIF2, a 160 kDa transcriptional mediator for the ligand-dependent
            activation function AF-2 of nuclear receptors
  JOURNAL   EMBO J. 15(14), 3667-3675(1996).
   PUBMED   8670870
REFERENCE   2  (bases 1 to 6156)
  AUTHORS   Voegel,J.J.
  JOURNAL   Submitted (22-APR-1996) to the INSDC. J.J. Voegel, IGBMC Inst.de
            Genet.et Biol.Mol.et Cell., CNRS-INSERM-Univ.Louis Pasteur,
            B.P.163, C.U. de Strasbourg, F-67404 ILLKIRCH CEDEX, FRANCE
  REMARK    Revised by author 25-JUL-96 and 10-MAR-97
COMMENT     Related sequences U39060, U40396
FEATURES             Location/Qualifiers
     source          1..6156
                     /db_xref="H-InvDB:HIT000325013"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /clone_lib="lambdaEXlox Ref.No.56"
                     /tissue_type="placenta"
                     /db_xref="taxon:9606"
     CDS             163..4557
                     /gene="TIF2"
                     /product="transcriptional intermediary factor 2"
                     /function="transcriptional mediator for ligand-dependent
                     activation function AF-2 of nuclear receptors"
                     /db_xref="GOA:Q15596"
                     /db_xref="H-InvDB:HIT000325013.14"
                     /db_xref="HGNC:HGNC:7669"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR001610"
                     /db_xref="InterPro:IPR008955"
                     /db_xref="InterPro:IPR009110"
                     /db_xref="InterPro:IPR010011"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="InterPro:IPR014920"
                     /db_xref="InterPro:IPR014935"
                     /db_xref="InterPro:IPR017426"
                     /db_xref="PDB:1GWQ"
                     /db_xref="PDB:1GWR"
                     /db_xref="PDB:1M2Z"
                     /db_xref="PDB:1MV9"
                     /db_xref="PDB:1MVC"
                     /db_xref="PDB:1MZN"
                     /db_xref="PDB:1P93"
                     /db_xref="PDB:1T63"
                     /db_xref="PDB:1T65"
                     /db_xref="PDB:1UHL"
                     /db_xref="PDB:1YOK"
                     /db_xref="PDB:1ZDT"
                     /db_xref="PDB:1ZDU"
                     /db_xref="PDB:1ZKY"
                     /db_xref="PDB:2AO6"
                     /db_xref="PDB:2B1V"
                     /db_xref="PDB:2B1Z"
                     /db_xref="PDB:2B23"
                     /db_xref="PDB:2FAI"
                     /db_xref="PDB:2G44"
                     /db_xref="PDB:2G5O"
                     /db_xref="PDB:2P15"
                     /db_xref="PDB:2P1T"
                     /db_xref="PDB:2P1U"
                     /db_xref="PDB:2P1V"
                     /db_xref="PDB:2Q7J"
                     /db_xref="PDB:2Q7L"
                     /db_xref="PDB:2ZXZ"
                     /db_xref="PDB:2ZY0"
                     /db_xref="PDB:3A9E"
                     /db_xref="PDB:3CLD"
                     /db_xref="PDB:3DZU"
                     /db_xref="PDB:3DZY"
                     /db_xref="PDB:3E00"
                     /db_xref="PDB:3E7C"
                     /db_xref="PDB:3E94"
                     /db_xref="PDB:3FUG"
                     /db_xref="PDB:3GN8"
                     /db_xref="PDB:3K22"
                     /db_xref="PDB:3K23"
                     /db_xref="PDB:3KWY"
                     /db_xref="PDB:3KYT"
                     /db_xref="PDB:3L0E"
                     /db_xref="PDB:3L0J"
                     /db_xref="PDB:3L0L"
                     /db_xref="PDB:3O1D"
                     /db_xref="PDB:3O1E"
                     /db_xref="PDB:3OAP"
                     /db_xref="PDB:3OZJ"
                     /db_xref="PDB:3PCU"
                     /db_xref="PDB:3PLZ"
                     /db_xref="PDB:3Q95"
                     /db_xref="PDB:3Q97"
                     /db_xref="PDB:3R5M"
                     /db_xref="PDB:3UP0"
                     /db_xref="PDB:3UP3"
                     /db_xref="PDB:4DOS"
                     /db_xref="PDB:4E2J"
                     /db_xref="PDB:4FHH"
                     /db_xref="PDB:4FHI"
                     /db_xref="PDB:4IA1"
                     /db_xref="PDB:4IA2"
                     /db_xref="PDB:4IA3"
                     /db_xref="PDB:4IA7"
                     /db_xref="PDB:4IQR"
                     /db_xref="PDB:4IU7"
                     /db_xref="PDB:4IUI"
                     /db_xref="PDB:4IV2"
                     /db_xref="PDB:4IV4"
                     /db_xref="PDB:4IVW"
                     /db_xref="PDB:4IVY"
                     /db_xref="PDB:4IW6"
                     /db_xref="PDB:4IW8"
                     /db_xref="PDB:4IWC"
                     /db_xref="PDB:4IWF"
                     /db_xref="PDB:4K4J"
                     /db_xref="PDB:4K6I"
                     /db_xref="PDB:4NIE"
                     /db_xref="UniProtKB/Swiss-Prot:Q15596"
                     /protein_id="CAA66263.1"
                     /translation="MSGMGENTSDPSRAETRKRKECPDQLGPSPKRNTEKRNREQENK
                     YIEELAELIFANFNDIDNFNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDV
                     SSTGQGVIDKDALGPMMLEALDGFFFVVNLEGNVVFVSENVTQYLRYNQEELMNKSVY
                     SILHVGDHTEFVKNLLPKSIVNGGSWSGEPPRRNSHTFNCRMLVKPLPDSEEEGHDNQ
                     EAHQKYETMQCFAVSQPKSIKEEGEDLQSCLICVARRVPMKERPVLPSSESFTTRQDL
                     QGKITSLDTSTMRAAMKPGWEDLVRRCIQKFHAQHEGESVSYAKRHHHEVLRQGLAFS
                     QIYRFSLSDGTLVAAQTKSKLIRSQTTNEPQLVISLHMLHREQNVCVMNPDLTGQTMG
                     KPLNPISSNSPAHQALCSGNPGQDMTLSSNINFPINGPKEQMGMPMGRFGGSGGMNHV
                     SGMQATTPQGSNYALKMNSPSQSSPGMNPGQPTSMLSPRHRMSPGVAGSPRIPPSQFS
                     PAGSLHSPVGVCSSTGNSHSYTNSSLNALQALSEGHGVSLGSSLASPDLKMGNLQNSP
                     VNMNPPPLSKMGSLDSKDCFGLYGEPSEGTTGQAESSCHPGEQKETNDPNLPPAVSSE
                     RADGQSRLHDSKGQTKLLQLLTTKSDQMEPSPLASSLSDTNKDSTGSLPGSGSTHGTS
                     LKEKHKILHRLLQDSSSPVDLAKLTAEATGKDLSQESSSTAPGSEVTIKQEPVSPKKK
                     ENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPASNTKLIAMKTEKEEMSFEPGDQ
                     PGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSVDKQAIINDLMQLTAENSPVTPV
                     GAQKTALRISQSTFNNPRPGQLGRLLPNQNLPLDITLQSPTGAGPFPPIRNSSPYSVI
                     PQPGMMGNQGMIGNQGNLGNSSTGMIGNSASRPTMPSGEWAPQSSAVRVTCAATTSAM
                     NRPVQGGMIRNPAASIPMRPSSQPGQRQTLQSQVMNIGPSELEMNMGGPQYSQQQAPP
                     NQTAPWPESILPIDQASFASQNRQPFGSSPDDLLCPHPAAESPSDEGALLDQLYLALR
                     NFDGLEEIDRALGIPELVSQSQAVDPEQFSSQDSNIMLEQKAPVFPQQYASQAQMAQG
                     SYSPMQDPNFHTMGQRPSYATLRMQPRPGLRPTGLVQNQPNQLRLQLQHRLQAQQNRQ
                     PLMNQISNVSNVNLTLRPGVPTQAPINAQMLAQRQREILNQHLRQRQMHQQQQVQQRT
                     LMMRGQGLNMTPSMVAPSGMPATMSNPRIPQANAQQFPFPPNYGISQQPDPGFTGATT
                     PQSPLMSPRMAHTQSPMMQQSQANPAYQAPSDINGWAQGNMGGNSMFSQQSPPHFGQQ
                     ANTSMYSNNMNINVSMATNTGGMSSMNQMTGQISMTSVTSVPTSGLSSMGPEQVNDPA
                     LRGGNLFPNQLPGMDMIKQEGDTTRKYC"
     misc_feature    2768..2974
                     /note="putative alternatively spliced region"
BASE COUNT         1799 a         1493 c         1406 g         1458 t
ORIGIN
        1 ggcggccgca gcctcggcta cagcttcggc ggcgaaggtc agcgccgacg gcagccggca
       61 cctgacggcg tgaccgaccc gagccgattt ctcttggatt tggctacaca cttatagatc
      121 ttctgcactg tttacaggca cagttgctga tatgtgttca agatgagtgg gatgggagaa
      181 aatacctctg acccctccag ggcagagaca agaaagcgca aggaatgtcc tgaccaactt
      241 ggacccagcc ccaaaaggaa cactgaaaaa cgtaatcgtg aacaggaaaa taaatatata
      301 gaagaacttg cagagttgat ttttgcaaat tttaatgata tagacaactt taacttcaaa
      361 cctgacaaat gtgcaatctt aaaagaaact gtgaagcaaa ttcgtcagat caaagaacaa
      421 gagaaagcag cagctgccaa catagatgaa gtgcagaagt cagatgtatc ctctacaggg
      481 cagggtgtca tcgacaagga tgcgctgggg cctatgatgc ttgaggccct tgatgggttc
      541 ttctttgtag tgaacctgga aggcaacgtt gtgtttgtgt cagagaatgt gacacagtat
      601 ctaaggtata accaagaaga gctgatgaac aaaagtgtat atagcatctt gcatgttggg
      661 gaccacacgg aatttgtcaa aaacctgctg ccaaagtcta tagtaaatgg gggatcttgg
      721 tctggcgaac ctccgaggcg gaacagccat accttcaatt gtcggatgct ggtaaaacct
      781 ttacctgatt cagaagagga gggtcatgat aaccaggaag ctcatcagaa atatgaaact
      841 atgcagtgct tcgctgtctc tcaaccaaag tccatcaaag aagaaggaga agatttgcag
      901 tcctgcttga tttgcgtggc aagaagagtt cccatgaagg aaagaccagt tcttccctca
      961 tcagaaagtt ttactactcg ccaggatctc caaggcaaga tcacgtctct ggataccagc
     1021 accatgagag cagccatgaa accaggctgg gaggacctgg taagaaggtg tattcagaag
     1081 ttccatgcgc agcatgaagg agaatctgtg tcctatgcta agaggcatca tcatgaagta
     1141 ctgagacaag gattggcatt cagtcaaatc tatcgttttt ccttgtctga tggcactctt
     1201 gttgctgcac aaacgaagag caaactcatc cgttctcaga ctactaatga acctcaactt
     1261 gtaatatctt tacatatgct tcacagagag cagaatgtgt gtgtgatgaa tccggatctg
     1321 actggacaaa cgatggggaa gccactgaat ccaattagct ctaacagccc tgcccatcag
     1381 gccctgtgca gtgggaaccc aggtcaggac atgaccctca gtagcaatat aaattttccc
     1441 ataaatggcc caaaggaaca aatgggcatg cccatgggca ggtttggtgg ttctggggga
     1501 atgaaccatg tgtcaggcat gcaagcaacc actcctcagg gtagtaacta tgcactcaaa
     1561 atgaacagcc cctcacaaag cagccctggc atgaatccag gacagcccac ctccatgctt
     1621 tcaccaaggc atcgcatgag ccctggagtg gctggcagcc ctcgaatccc acccagtcag
     1681 ttttcccctg caggaagctt gcattcccct gtgggagttt gcagcagcac aggaaatagc
     1741 catagttata ccaacagctc cctcaatgca cttcaggccc tcagcgaggg gcacggggtc
     1801 tcattagggt catcgttggc ttcaccagac ctaaaaatgg gcaatttgca aaactcccca
     1861 gttaatatga atcctccccc actcagcaag atgggaagct tggactcaaa agactgtttt
     1921 ggactatatg gggagccctc tgaaggtaca actggacaag cagagagcag ctgccatcct
     1981 ggagagcaaa aggaaacaaa tgaccccaac ctgcccccgg ccgtgagcag tgagagagct
     2041 gacgggcaga gcagactgca tgacagcaaa gggcagacca aactcctgca gctgctgacc
     2101 accaaatctg atcagatgga gccctcgccc ttagccagct ctttgtcgga tacaaacaaa
     2161 gactccacag gtagcttgcc tggttctggg tctacacatg gaacctcgct caaggagaag
     2221 cataaaattt tgcacagact cttgcaggac agcagttccc ctgtggactt ggccaagtta
     2281 acagcagaag ccacaggcaa agacctgagc caggagtcca gcagcacagc tcctggatca
     2341 gaagtgacta ttaaacaaga gccggtgagc cccaagaaga aagagaatgc actacttcgc
     2401 tatttgctag ataaagatga tactaaagat attggtttac cagaaataac ccccaaactt
     2461 gagagactgg acagtaagac agatcctgcc agtaacacaa aattaatagc aatgaaaact
     2521 gagaaggagg agatgagctt tgagcctggt gaccagcctg gcagtgagct ggacaacttg
     2581 gaggagattt tggatgattt gcagaatagt caattaccac agcttttccc agacacgagg
     2641 ccaggcgccc ctgctggatc agttgacaag caagccatca tcaatgacct catgcaactc
     2701 acagctgaaa acagccctgt cacacctgtt ggagcccaga aaacagcact gcgaatttca
     2761 cagagcactt ttaataaccc acgaccaggg caactgggca ggttattgcc aaaccagaat
     2821 ttaccacttg acatcacatt gcaaagccca actggtgctg gacctttccc accaatcaga
     2881 aacagtagtc cctactcagt gatacctcag ccaggaatga tgggtaatca agggatgata
     2941 ggaaaccaag gaaatttagg gaacagtagc acaggaatga ttggtaacag tgcttctcgg
     3001 cctactatgc catctggaga atgggcaccg cagagttcgg ctgtgagagt cacctgtgct
     3061 gctaccacca gtgccatgaa ccggccagtc caaggaggta tgattcggaa cccagcagcc
     3121 agcatcccca tgaggcccag cagccagcct ggccaaagac agacgcttca gtctcaggtc
     3181 atgaatatag ggccatctga attagagatg aacatggggg gacctcagta tagccaacaa
     3241 caagctcctc caaatcagac tgccccatgg cctgaaagca tcctgcctat agaccaggcg
     3301 tcttttgcca gccaaaacag gcagccattt ggcagttctc cagatgactt gctatgtcca
     3361 catcctgcag ctgagtctcc gagtgatgag ggagctctcc tggaccagct gtatctggcc
     3421 ttgcggaatt ttgatggcct ggaggagatt gatagagcct taggaatacc cgaactggtc
     3481 agccagagcc aagcagtaga tccagaacag ttctcaagtc aggattccaa catcatgctg
     3541 gagcagaagg cgcccgtttt cccacagcag tatgcatctc aggcacaaat ggcccagggt
     3601 agctattctc ccatgcaaga tccaaacttt cacaccatgg gacagcggcc tagttatgcc
     3661 acactccgta tgcagcccag accgggcctc aggcccacgg gcctagtgca gaaccagcca
     3721 aatcaactaa gacttcaact tcagcatcgc ctccaagcac agcagaatcg ccagccactt
     3781 atgaatcaaa tcagcaatgt ttccaatgtg aacttgactc tgaggcctgg agtaccaaca
     3841 caggcaccta ttaatgcaca gatgctggcc cagagacaga gggaaatcct gaaccagcat
     3901 cttcgacaga gacaaatgca tcagcaacag caagttcagc aacgaacttt gatgatgaga
     3961 ggacaagggt tgaatatgac accaagcatg gtggctccta gtggtatgcc agcaactatg
     4021 agcaaccctc ggattcccca ggcaaatgca cagcagtttc catttcctcc aaactacgga
     4081 ataagtcagc aacctgatcc aggctttact ggggctacga ctccccagag cccacttatg
     4141 tcaccccgaa tggcacatac acagagtccc atgatgcaac agtctcaggc caacccagcc
     4201 tatcaggccc cctccgacat aaatggatgg gcgcagggga acatgggcgg aaacagcatg
     4261 ttttcccagc agtccccacc acactttggg cagcaagcaa acaccagcat gtacagtaac
     4321 aacatgaaca tcaatgtgtc catggcgacc aacacaggtg gcatgagcag catgaaccag
     4381 atgacaggac agatcagcat gacctcagtg acctccgtgc ctacgtcagg gctgtcctcc
     4441 atgggtcccg agcaggttaa tgatcctgct ctgaggggag gcaacctgtt cccaaaccag
     4501 ctgcctggaa tggatatgat taagcaggag ggagacacaa cacggaaata ttgctgacac
     4561 tgctgaagcc agttgcttct tcagctgacc gggctcactt gctcaaaaca cttccagtct
     4621 ggagagctgt gtctatttgt ttcaacccaa ctgacctgcc agccggttct gctagagcag
     4681 acaggcctgg ccctggttcc cagggtggcg tccactcggc tgtggcagga ggagctgcct
     4741 cttctcttga cagtctgaag ctcgcatcca gacagtcgct cagtctgttc cctgcattca
     4801 ccttagtgca acttagatct ctcctcccca agtaaatgtt gacaggccaa tttcataccc
     4861 atgtcagatt gaatgtattt aaatgtatgt atttaaggag aaccatgctc ttgttctgtt
     4921 cctgttcggt tccagacact ggtttcttgc tttgttttcc ctggctaaca gtctagtgcc
     4981 aaagattaag attttatctg ggggaaagaa aagaattttt taaaaaatta aactaaagat
     5041 gttttaagct aaagcctgaa tttgggatgg aagcaggaca gacaccgtgg acagcgctgt
     5101 atttacagac acacccagtg cgtgaagacc aacaaagtca cagtcgtatc tctagaaagc
     5161 tctaaagacc atgttggaaa gagtctccag ttactgaaca gatgaaaagg agcctgtgag
     5221 agggctgtta acattagcaa atattttttc cttgtttttt ctttgttaaa accaaactgg
     5281 ttcacctgaa tcatgaattg agaagaaata attttcattt ctaaattaag tcccttttag
     5341 tttgatcaga cagcttgaat cagcatctct tcttccctgt cagcctgact cttcccttcc
     5401 cctctctcat tccccatact ccctattttc attccttttt taaaaaataa tataagctac
     5461 agaaaccagg taagcccttt atttccttaa atgttttgcc agccacttac caattgctaa
     5521 gtattgaatt tcagaaaaaa aaaatgcatt tactggcaag gagaagagca aagttaaggc
     5581 ttgataccaa tcgagctaag gatacctgct ttggaagcat gtttattctg ttccccagca
     5641 actctggcct ccaaaatggg agaaacgcca gtgtgtttaa attgatagca gatatcacga
     5701 cagatttaac ctctgccatg tgttttttat tttgtttttt agcagtgctg actaagccga
     5761 agttttgtaa ggtacataaa atccaattta tatgtaaaca agcaataatt taagttgaga
     5821 acttatgtgt tttaattgta taatttttgt gaggtataca tattgtggaa ttgactcaaa
     5881 aatgaggtac ttcagtatta aattagatat cttcatagca atgtctccta aaggtgtttt
     5941 gtaaaggata tcaatgcctt gattagacct aatttgtaga cttaagactt tttattttct
     6001 aaaccttgtg attctgctta taagtcattt atctaatcta tatgatatgc agccgctgta
     6061 ggaaccaatt cttgattttt atatgtttat attctttctt aatgaacctt agaaagacta
     6121 catgttacta agcaggccac ttttatggtt gttttt
//