LOCUS       X87159                  2564 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  H.sapiens mRNA for beta subunit of epithelial amiloride-sensitive
            sodium channel.
ACCESSION   X87159
VERSION     X87159.1
KEYWORDS    beta subunit; epithelial amiloride-sensitive sodium channel;
            epithelial sodium channel; SCNN1 gene.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1
  AUTHORS   Voilley,N., Bassilana,F., Migon,C., Merscher,S., Mattei,M.G.,
            Carle,G.F., Lazdunski,M. and  Barbry,P.
  TITLE     Cloning, chromosomal localization, and physical linkage of the beta
            and gamma subunits (SCNN1B and SCNN1G) of the human epithelial
            amiloride-sensitive sodium channel
  JOURNAL   Genomics 28(3), 560-565(1995).
   PUBMED   7490094
REFERENCE   2  (bases 1 to 2564)
  AUTHORS   Voilley,N.
  JOURNAL   Submitted (11-MAY-1995) to the INSDC. N. Voilley, CNRS-UPR411,
            Inst.de Pharmacologie molecularie et cellulaire, 660 route des
            Lucioles Sophia Antipolis, F- 06560 Valbonne, FRANCE
COMMENT     Related sequence: U16023
FEATURES             Location/Qualifiers
     source          1..2564
                     /db_xref="H-InvDB:HIT000324262"
                     /organism="Homo sapiens"
                     /chromosome="16"
                     /map="16p12-13"
                     /mol_type="mRNA"
                     /dev_stage="adult"
                     /tissue_type="lung"
                     /db_xref="taxon:9606"
     CDS             128..2050
                     /gene="SCNN1B"
                     /product="epithelial amiloride-sensitive sodium channel,
                     beta-subunit"
                     /db_xref="GOA:P51168"
                     /db_xref="H-InvDB:HIT000324262.14"
                     /db_xref="HGNC:HGNC:10600"
                     /db_xref="InterPro:IPR001873"
                     /db_xref="InterPro:IPR004724"
                     /db_xref="InterPro:IPR020903"
                     /db_xref="UniProtKB/Swiss-Prot:P51168"
                     /protein_id="CAA60632.1"
                     /translation="MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICE
                     GPKKKAMWFLLTLLFAALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASP
                     FKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHH
                     PMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEW
                     YILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFN
                     WGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLASTGGVRLMLHEQRSYPFIRDEGI
                     YAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQ
                     DHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCND
                     TQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRKGIVKLNIYFQEFNYRTIE
                     ESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSLRQRR
                     AQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQALPIPGTPPPNYDSLR
                     LQPLDVIESDSEGDAI"
     misc_difference 1921..2384
                     /note="Region absent in other clone from same library; no
                     loss of function."
BASE COUNT          582 a          808 c          663 g          511 t
ORIGIN
        1 tcgccgggtg tcccagtgtc accaacactc ggccgccgcc gccagcttgg cgcgcaccgc
       61 cgcctccgcc accgccgaca gcgcgcatcc tccgtgtccc cgctccgccg cccgagcagg
      121 tgccactatg cacgtgaaga agtacctgct gaagggcctg catcggctgc agaagggccc
      181 cggctacacg tacaaggagc tgctggtgtg gtactgcgac aacaccaaca cccacggccc
      241 caagcgcatc atctgtgagg ggcccaagaa gaaagccatg tggttcctgc tcaccctgct
      301 cttcgccgcc ctcgtctgct ggcagtgggg catcttcatc aggacctact tgagctggga
      361 ggtcagcgtc tccctctccg taggcttcaa gaccatggac ttccccgccg tcaccatctg
      421 caatgctagc cccttcaagt attccaaaat caagcatttg ctgaaggacc tggatgagct
      481 gatggaagct gtcctggaga gaatcctggc tcctgagcta agccatgcca atgccaccag
      541 gaacctgaac ttctccatct ggaaccacac acccctggtc cttattgatg aacggaaccc
      601 ccaccacccc atggtccttg atctctttgg agacaaccac aatggcttaa caagcagctc
      661 agcatcagaa aagatctgta atgcccacgg gtgcaaaatg gccatgagac tatgtagcct
      721 caacaggacc cagtgtacct tccggaactt caccagtgct acccaggcat tgacagagtg
      781 gtacatcctg caggccacca acatctttgc acaggtgcca cagcaggagc tagtagagat
      841 gagctacccc ggcgagcaga tgatcctggc ctgcctattc ggagctgagc cctgcaacta
      901 ccggaacttc acgtccatct tctaccctca ctatggcaac tgttacatct tcaactgggg
      961 catgacagag aaggcacttc cttcggccaa ccctggaact gaattcggcc tgaagttgat
     1021 cctggacata ggccaggaag actacgtccc cttccttgcg tccacgggcg gggtcaggct
     1081 gatgcttcac gagcagaggt catacccctt catcagagat gagggcatct acgccatgtc
     1141 ggggacagag acgtccatcg gggtactcgt ggataagctt cagcgcatgg gggagcccta
     1201 cagcccgtgc accgtgaatg gttctgaggt ccccgtccaa aacttctaca gtgactacaa
     1261 cacgacctac tccatccagg cctgtcttcg ctcctgcttc caagaccaca tgatccgtaa
     1321 ctgcaactgt ggccactacc tgtacccact gccccgtggg gagaaatact gcaacaaccg
     1381 ggacttccca gactgggccc attgctactc agatctacag atgagcgtgg cgcagagaga
     1441 gacctgcatt ggcatgtgca aggagtcctg caatgacacc cagtacaaga tgaccatctc
     1501 catggctgac tggccttctg aggcctccga ggactggatt ttccacgtct tgtctcagga
     1561 gcgggaccaa agcaccaata tcaccctgag caggaaggga attgtcaagc tcaacatcta
     1621 cttccaagaa tttaactatc gcaccattga agaatcagca gccaataaca tcgtctggct
     1681 gctctcgaat ctgggtggcc agtttggctt ctggatgggg ggctctgtgc tgtgcctcat
     1741 cgagtttggg gagatcatca tcgactttgt gtggatcacc atcatcaagc tggtggcctt
     1801 ggccaagagc ctacggcagc ggcgagccca agccagctac gctggcccac cgcccaccgt
     1861 ggccgagctg gtggaggccc acaccaactt tggcttccag cctgacacgg ccccccgcag
     1921 ccccaacact gggccctacc ccagtgagca ggccctgccc atcccaggca ccccgccccc
     1981 caactatgac tccctgcgtc tgcagccgct ggacgtcatc gagtctgaca gtgagggtga
     2041 tgccatctaa ccctgcccct gtccaccccg ggtgggtgaa actcactgag cagccaagac
     2101 tgttgcccga ggactcactg tatggtgccc tctccaaagg gtcgggaggg tagctctcca
     2161 ggccagagct tgtgtccttc aacagagagg ccagcggcaa ctggtccgtt actggccaag
     2221 ggctctgaag aatcaacggt gctggtacag gatacaggaa taaattgtat cttcacctgg
     2281 ttcctaccct cgtccctacc tgtcctgatc ctggtcctga agacccctcg gaacaccctc
     2341 tcctggtggc aggccacttc cctcccagtg ccagtctcca tccaccccag agaggaacag
     2401 gcgggtgggc catgtggttt tctccttcct ggccttggct ggcctctggg gcaggggtgg
     2461 tggagagatg gaagggcatc aggtgtaggg accctgccaa gtggcacctg atttactcta
     2521 gaaaataaaa gtagaaaata ctgagaaaaa aaaaaaaaaa aaaa
//