LOCUS       X84075                  4575 bp    mRNA    linear   HUM 07-JUL-1995
DEFINITION  H.sapiens mRNA for cardiac myosin binding protein-C.
ACCESSION   X84075
VERSION     X84075.1
KEYWORDS    cardiac myosin-binding protein; Mybp-C gene.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1
  AUTHORS   Gautel,M., Zuffardi,O., Freiburg,A. and  Labeit,S.
  TITLE     Phosphorylation switches specific for the cardiac isoform of myosin
            binding protein-C: a modulator of cardiac contraction?
  JOURNAL   EMBO J. 14(9), 1952-1960(1995).
   PUBMED   7744002
REFERENCE   2  (bases 1 to 4575)
  AUTHORS   Labeit,S.
  JOURNAL   Submitted (25-JAN-1995) to the INSDC. S. Labeit, EMBL Heidelberg,
            Meyerhofstr. 1, 69117 Heidelberg, FRG
  REMARK    Sequence revised by author, 19-MAY-95
FEATURES             Location/Qualifiers
     source          1..4575
                     /db_xref="H-InvDB:HIT000324022"
                     /organism="Homo sapiens"
                     /chromosome="11"
                     /map="p11.2"
                     /variety="caucasian"
                     /isolate="CCPR"
                     /mol_type="mRNA"
                     /dev_stage="adult"
                     /clone_lib="Stratagene #936208"
                     /tissue_type="heart"
                     /db_xref="taxon:9606"
     CDS             33..3857
                     /gene="Mybp-C"
                     /product="cardiac myosin-binding protein C"
                     /db_xref="GOA:Q14896"
                     /db_xref="H-InvDB:HIT000324022.14"
                     /db_xref="HGNC:HGNC:7551"
                     /db_xref="InterPro:IPR003598"
                     /db_xref="InterPro:IPR003599"
                     /db_xref="InterPro:IPR003961"
                     /db_xref="InterPro:IPR007110"
                     /db_xref="InterPro:IPR013098"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="PDB:1GXE"
                     /db_xref="PDB:1PD6"
                     /db_xref="PDB:2AVG"
                     /db_xref="PDB:2K1M"
                     /db_xref="PDB:2V6H"
                     /db_xref="PDB:3CX2"
                     /db_xref="UniProtKB/Swiss-Prot:Q14896"
                     /protein_id="CAA58882.1"
                     /translation="MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQR
                     GGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEP
                     MLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMR
                     PQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASK
                     VYLFELHITDAQPAFTGSYRCEVSTKDKFECSNFNLTVHEAMGTGDLDLLSAFRRTSL
                     AGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQAPPSEYE
                     RIAFQYGVTDLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDA
                     EVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFVK
                     EPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGQ
                     RHHLIINEAMLEDAGHYALCTSGGQALRELIVQEKKLEVYQSIADLMVGAKDQAVFKC
                     EVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACN
                     LSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVI
                     WQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEG
                     AEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYD
                     GGQPILGYILERKKKKSYRWMQLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSR
                     PSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCS
                     EWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPR
                     LQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTIL
                     FIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKP
                     PQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVG
                     FSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAV
                     RGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEA
                     RCECRLEVRVPQ"
     misc_feature    33..335
                     /note="N-terminal module possibly specific to cardiac
                     isomorfs"
     misc_feature    336..488
                     /note="prolin-rich N-terminal domain"
     misc_feature    489..799
                     /note="module I (IgG)"
     misc_feature    801..1115
                     /note="phosphorylation domain (cardiac-specific Mubp-C
                     motif)"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_feature    1116..1388
                     /note="module II (IgG)"
     misc_feature    1389..1661
                     /note="module III (IgG)"
     misc_feature    1662..1931
                     /note="module IV (IgG)"
     misc_feature    1932..1964
                     /note="unique insertion"
     misc_feature    1965..2345
                     /note="module V (Ig G)"
     misc_feature    2346..2639
                     /note="module VI (fn-3)"
     misc_feature    2640..2942
                     /note="module VII (fn-3)"
     misc_feature    2943..3227
                     /note="module VIII (IgG)"
     misc_feature    3228..3572
                     /note="module IX (fn-3)"
     misc_feature    3573..3854
                     /note="module X (Ig G)"
BASE COUNT         1033 a         1310 c         1393 g          839 t
ORIGIN
        1 catggtgagt gcctggtgtg acgtctctca ggatgcctga gccggggaag aagccagtct
       61 cagcctttag caagaagcca cggtcagtgg aagtggccgc aggcagccct gccgtgttcg
      121 aggccgagac agagcgggca ggagtgaagg tgcgctggca gcgcggaggc agtgacatca
      181 gcgccagcaa caagtacggc ctggccacag agggcacacg gcatacgctg acagtgcggg
      241 aagtgggccc tgccgaccag ggatcttacg cagtcattgc tggctcctcc aaggtcaagt
      301 tcgacctcaa ggtcatagag gcagagaagg cagagcccat gctggcccct gcccctgccc
      361 ctgctgaggc cactggagcc cctggagaag ccccggcccc agccgctgag ctgggagaaa
      421 gtgccccaag tcccaaaggg tcaagctcag cagctctcaa tggtcctacc cctggagccc
      481 ccgatgaccc cattggcctc ttcgtgatgc ggccacagga tggcgaggtg accgtgggtg
      541 gcagcatcac cttctcagcc cgcgtggccg gcgccagcct cctgaagccg cctgtggtca
      601 agtggttcaa gggcaaatgg gtggacctga gcagcaaggt gggccagcac ctgcagctgc
      661 acgacagcta cgaccgcgcc agcaaggtct atctgttcga gctgcacatc accgatgccc
      721 agcctgcctt cactggcagc taccgctgtg aggtgtccac caaggacaaa tttgaatgct
      781 ccaacttcaa tctcactgtc cacgaggcca tgggcaccgg agacctggac ctcctatcag
      841 ccttccgccg cacgagcctg gctggaggtg gtcggcggat cagtgatagc catgaggaca
      901 ctgggattct ggacttcagc tcactgctga aaaagagaga cagtttccgg accccgaggg
      961 actcgaagct ggaggcacca gcagaggagg acgtgtggga gatcctacgg caggcacccc
     1021 catctgagta cgagcgcatc gccttccagt acggcgtcac tgacctgcgc ggcatgctaa
     1081 agaggctcaa gggcatgagg cgcgatgaga agaagagcac agcctttcag aagaagctgg
     1141 agccggccta ccaggtgagc aaaggccaca agatccggct gaccgtggaa ctggctgacc
     1201 atgacgctga ggtcaaatgg ctcaagaatg gccaggagat ccagatgagc ggcagcaagt
     1261 acatctttga gtccatcggt gccaagcgta ccctgaccat cagccagtgc tcattggcgg
     1321 acgacgcagc ctaccagtgc gtggtgggtg gcgagaagtg tagcacggag ctctttgtga
     1381 aagagccccc tgtgctcatc acgcgcccct tggaggacca gctggtgatg gtggggcagc
     1441 gggtggagtt tgagtgtgaa gtatcggagg agggggcgca agtcaaatgg ctgaaggacg
     1501 gggtggagct gacccgggag gagaccttca aataccggtt caagaaggac gggcagagac
     1561 accacctgat catcaacgag gccatgctgg aggacgcggg gcactatgca ctgtgcacta
     1621 gcgggggcca ggcgctgcgt gagctcattg tgcaggaaaa gaagctggag gtgtaccaga
     1681 gcatcgcaga cctgatggtg ggcgcaaagg accaggcggt gttcaaatgt gaggtctcag
     1741 atgagaatgt tcggggtgtg tggctgaaga atgggaagga gctggtgccc gacagccgca
     1801 taaaggtgtc ccacatcggg cgggtccaca aactgaccat tgacgacgtc acacctgccg
     1861 acgaggctga ctacagcttt gtgcccgagg gcttcgcctg caacctgtca gccaagctcc
     1921 acttcatgga ggtcaagatt gacttcgtac ccaggcagga acctcccaag atccacctgg
     1981 actgcccagg ccgcatacca gacaccattg tggttgtagc tggaaataag ctacgtctgg
     2041 acgtccctat ctctggggac cctgctccca ctgtgatctg gcagaaggct atcacgcagg
     2101 ggaataaggc cccagccagg ccagccccag atgccccaga ggacacaggt gacagcgatg
     2161 agtgggtgtt tgacaagaag ctgctgtgtg agaccgaggg ccgggtccgc gtggagacca
     2221 ccaaggaccg cagcatcttc acggtcgagg gggcagagaa ggaagatgag ggcgtctaca
     2281 cggtcacagt gaagaaccct gtgggcgagg accaggtcaa cctcacagtc aaggtcatcg
     2341 acgtgccaga cgcacctgcg gcccccaaga tcagcaacgt gggagaggac tcctgcacag
     2401 tacagtggga gccgcctgcc tacgatggcg ggcagcccat cctgggctac atcctggagc
     2461 gcaagaagaa gaagagctac cggtggatgc agctgaactt cgacctgatt caggagctga
     2521 gtcatgaagc gcggcgcatg atcgagggcg tggtgtacga gatgcgcgtc tacgcggtca
     2581 acgccatcgg catgtccagg cccagccctg cctcccagcc cttcatgcct atcggtcccc
     2641 ccagcgaacc cacccacctg gcagtagagg acgtctctga caccacggtc tccctcaagt
     2701 ggcggccccc agagcgcgtg ggagcaggag gcctggatgg ctacagcgtg gagtactgcc
     2761 cagagggctg ctcagagtgg gtggctgccc tgcaggggct gacagagcac acatcgatac
     2821 tggtgaagga cctgcccacg ggggcccggc tgcttttccg agtgcgggca cacaatatgg
     2881 cagggcctgg agcccctgtt accaccacgg agccggtgac agtgcaggag atcctgcaac
     2941 ggccacggct tcagctgccc aggcacctgc gccagaccat tcagaagaag gtcggggagc
     3001 ctgtgaacct tctcatccct ttccagggca agccccggcc tcaggtgacc tggaccaaag
     3061 aggggcagcc cctggcaggc gaggaggtga gcatccgcaa cagccccaca gacaccatcc
     3121 tgttcatccg ggccgctcgc cgcgtgcatt caggcactta ccaggtgacg gtgcgcattg
     3181 agaacatgga ggacaaggcc acgctggtgc tgcaggttgt tgacaagcca agtcctcccc
     3241 aggatctccg ggtgactgac gcctggggtc ttaatgtggc tctggagtgg aagccacccc
     3301 aggatgtcgg caacacggaa ctctgggggt acacagtgca gaaagccgac aagaagacca
     3361 tggagtggtt caccgtcttg gagcattacc gccgcaccca ctgcgtggtg ccagagctca
     3421 tcattggcaa tggctactac ttccgcgtct tcagccagaa tatggttggc tttagtgaca
     3481 gagcggccac caccaaggag cccgtcttta tccccagacc aggcatcacc tatgagccac
     3541 ccaactataa ggccctggac ttctccgagg ccccaagctt cacccagccc ctggtgaacc
     3601 gctcggtcat cgcgggctac actgctatgc tctgctgtgc tgtccggggt agccccaagc
     3661 ccaagatttc ctggttcaag aatggcctgg acctgggaga agacgcccgc ttccgcatgt
     3721 tcagcaagca gggagtgttg actctggaga ttagaaagcc ctgccccttt gacgggggca
     3781 tctatgtctg cagggccacc aacttacagg gcgaggcacg gtgtgagtgc cgcctggagg
     3841 tgcgagtgcc tcagtgacca ggctggctcc tggggatggc caggtacaac cggatgccag
     3901 ccccgtgcca ggagcctgga gggaagttgg ggaaacccct ccctactgtt ggatgtatgt
     3961 gtgacaagtg tgtctcctgt gctgcgatgg gggatcagca gggcagttgt cgggcagtcc
     4021 tgagtgggtg ttgcacagac tggtccacag ggctcctgaa ggaagcccct ggatctttgg
     4081 ggtaaaagga gggtggcctc aagaaacaat gtctggggac aggcctttct ggcctgctat
     4141 gtcttcccaa tgtttattgg gcaataaaag ataagtgcag tcacagagaa ctcactcttc
     4201 atcacctgag ctcaccatag tctaatagaa aacaaccgaa accaaataat tcaagcactg
     4261 cttattacaa ttttactggg tctctatttt accctcctac aagcctcaga gtacttcgag
     4321 tctcccttca ccatttccga cggcatctac ggctcaacat tttttgtagc cacaggcttc
     4381 cacggacttc acgtcattat tggctcaact ttcctcacta tctgcttcat ccgccaacta
     4441 atatttcact ttacatccaa acatcacttt ggcttcgaag ccgccgcctg atactggcat
     4501 tttgtagatg tggtttgact atttctgtat gtctccatct attgatgagg gtcttaaaaa
     4561 aaaaaaaaaa aaaaa
//