LOCUS       X83413                159378 bp    DNA     linear   VRL 08-FEB-2018
DEFINITION  Human betaherpesvirus 6A, variant A DNA, complete virion genome,
            isolate U1102.
ACCESSION   X83413
VERSION     X83413.2
KEYWORDS    .
SOURCE      Human betaherpesvirus 6A
  ORGANISM  Human betaherpesvirus 6A
            Viruses; Herpesvirales; Herpesviridae; Betaherpesvirinae;
            Roseolovirus.
REFERENCE   1  (bases 1 to 159378)
  AUTHORS   Gompels U.A., Nicholas J., Lawrence G., Jones M., Thomson B.J.,
            Martin M.E., Efstathiou S., Craxton M., Macaulay H.A.
  TITLE     The DNA sequence of human herpesvirus-6: structure, coding content,
            and genome evolution
  JOURNAL   Virology 209(1), 29-51(1995).
   PUBMED   7747482
REFERENCE   2
  AUTHORS   Lawrence G.L., Chee M., Craxton M.A., Gompels U.A., Honess R.W.,
            Barrell B.G.
  TITLE     Human herpesvirus 6 is closely related to human cytomegalovirus
  JOURNAL   J. Virol. 64(1), 287-299(1990).
   PUBMED   2152817
REFERENCE   3
  AUTHORS   Chang C.K., Balachandran N.
  TITLE     Identification, characterization, and sequence analysis of a cDNA
            encoding a phosphoprotein of human herpesvirus 6
  JOURNAL   J. Virol. 65(6), 2884-2894(1991).
   PUBMED   1851860
REFERENCE   4
  AUTHORS   Teo I.A., Griffin B.E., Jones M.D.
  TITLE     Characterization of the DNA polymerase gene of human herpesvirus 6
  JOURNAL   J. Virol. 65(9), 4670-4680(1991).
   PUBMED   1651403
REFERENCE   5
  AUTHORS   Thomson B.J., Efstathiou S., Honess R.W.
  TITLE     Acquisition of the human adeno-associated virus type-2 rep gene by
            human herpesvirus type-6
  JOURNAL   Nature 351(6321), 78-80(1991).
   PUBMED   1851252
REFERENCE   6
  AUTHORS   Martin M.E.D., Nicholas J., Thomson B.J., Newman C., Honess R.W.
  TITLE     Identification of a transactivating function mapping to the
            putative immediate-early locus of human herpesvirus 6
  JOURNAL   J. Virol. 65(10), 5381-5390(1991).
   PUBMED   1654446
REFERENCE   7
  AUTHORS   Efstathiou S., Lawrence G.L., Brown C.M., Barrell B.G.
  TITLE     Identification of homologs to the human cytomegalovirus US22 gene
            family in human helpesvirus-6
  JOURNAL   J. Gen. Virol. 73, 1661-1671(1992).
   PUBMED   1321206
REFERENCE   8
  AUTHORS   Geng Y., Chandran B., Josephs S.F., Wood C.
  TITLE     Identification and characterization of a human herpesvirus 6 gene
            segment that trans activates the human immunodeficiency virus type
            1 promoter
  JOURNAL   J. Virol. 66(3), 1564-1570(1992).
   PUBMED   1310766
REFERENCE   9
  AUTHORS   Gompels U.A., Carss A.L., Sun N., Arrand J.R.
  TITLE     Infectivity determinants encoded in a conserved gene block of human
            herpesvirus-6
  JOURNAL   DNA Seq 3(1), 25-39(1992).
   PUBMED   1333836
REFERENCE   10
  AUTHORS   Neipel F., Ellinger K., Fleckenstein B.
  TITLE     Gene for the major antigenic structural protein (p100) of human
            herpesvirus 6
  JOURNAL   J. Virol. 66(6), 3918-3924(1992).
   PUBMED   1374813
REFERENCE   11
  AUTHORS   Thomson B.J., Honess R.W.
  TITLE     The right end of the unique region of the genome of human
            herpesvirus 6 U1102 contains a candidate immediate early gene
            enhancer and a homologue of the human cytomegalovirus US22 gene
            family
  JOURNAL   J. Gen. Virol. 73, 1649-1660(1992).
   PUBMED   1321205
REFERENCE   12
  AUTHORS   Ellinger K., Neipel F., Foa-Tomasi L., Campadelli-Fiume G.,
            Fleckenstein B.
  TITLE     The glycoprotein B homologue of human herpesvirus 6
  JOURNAL   J. Gen. Virol. 74, 495-500(1993).
   PUBMED   8383182
REFERENCE   13
  AUTHORS   Gompels U.A., Carrigan D.R., Carss A.L., Arno J.
  TITLE     Two groups of human herpesvirus 6 identified by sequence analyses
            of laboratory strains and variants from Hodgkin's lymphoma and bone
            marrow transplant patients
  JOURNAL   J. Gen. Virol. 74, 613-622(1993).
   PUBMED   8385692
REFERENCE   14
  AUTHORS   Liu D.X., Gompels U.A., Nicholas J., Lelliott C.
  TITLE     Identification and expression of the human herpesvirus 6
            glycoprotein H and interaction with an accessory 40K glycoprotein
  JOURNAL   J. Gen. Virol. 74, 1847-1857(1993).
   PUBMED   8397282
REFERENCE   15
  AUTHORS   Liu D.X., Gompels U.A., Foa-Tomasi L., Campadelli-Fiume G.
  TITLE     Human herpesvirus-6 glycoprotein H and L homologs are components of
            the gp100 complex and the gH external domain is the target for
            neutralizing monoclonal antibodies
  JOURNAL   Virology 197(1), 12-22(1993).
   PUBMED   7692666
REFERENCE   16
  AUTHORS   Pellett P.E., Sanchez-Martinez D., Dominguez G., Black J.B.,
            Anton E., Greenamoyer C., Dambaugh T.R.
  TITLE     A strongly immunoreactive virion protein of human herpesvirus 6
            variant B strain Z29: identification and characterization of the
            gene and mapping of a variant-specific monoclonal antibody reactive
            epitope
  JOURNAL   Virology 195(2), 521-531(1993).
   PUBMED   7687803
REFERENCE   17
  AUTHORS   Pfeiffer B., Berneman Z.N., Neipel F., Chang C.K., Tirwatnapong S.,
            Chandran B.
  TITLE     Identification and mapping of the gene encoding the glycoprotein
            complex gp82-gp105 of human herpesvirus 6 and mapping of the
            neutralizing epitope recognized by monoclonal antibodies
  JOURNAL   J. Virol. 67(8), 4611-4620(1993).
   PUBMED   7687301
REFERENCE   18
  AUTHORS   Gompels U.A., Macaulay H.A.
  TITLE     Characterisation of human telomeric repeat sequences from human
            herpesvirus-6 and relationship to replication
  JOURNAL   J. Gen. Virol. 76, 451-458(1995).
   PUBMED   7844567
REFERENCE   19
  AUTHORS   Dewhurst S., Dollard S.C., Pellett P.E., Dambaugh T.R.
  TITLE     Identification of a lytic-phase origin of DNA replication in human
            herpesvirus 6B strain Z29
  JOURNAL   J. Virol. 67(12), 7680-7683(1993).
   PUBMED   8230490
REFERENCE   20
  AUTHORS   Nicholas J.
  TITLE     Nucleotide sequence of a 21-kilobase-pair region of the genome of
            human herpesvirus-6 containing homologues of human cytomegalovirus
            major immediate-early and replication genes
  JOURNAL   Unpublished.
REFERENCE   21
  AUTHORS   Nicholas J., Martin M.
  TITLE     Nucleotide sequence analysis of a 38.5-kilobase-pair region of the
            genome of human herpesvirus 6 encoding human cytomegalovirus
            immediate-early gene homologs and transactivating functions
  JOURNAL   J. Virol. 68(2), 597-610(1994).
   PUBMED   8289364
REFERENCE   22
  AUTHORS   Schiewe U., Neipel F., Schreiner D., Fleckenstein B.
  TITLE     Structure and transcription of an immediate-early region in the
            human herpesvirus 6 genome
  JOURNAL   J. Virol. 68(5), 2978-2985(1994).
   PUBMED   8151768
REFERENCE   23
  AUTHORS   Thompson J., Choudhury S., Kashanchi F., Doniger J., Berneman Z.,
            Frenkel N., Rosenthal L.J.
  TITLE     A transforming fragment within the direct repeat region of human
            herpesvirus type 6 that transactivates HIV-1
  JOURNAL   Oncogene 9(4), 1167-1175(1994).
   PUBMED   8134119
REFERENCE   24
  AUTHORS   Zhou Y., Chang C.K., Qian G., Chandran B., Wood C.
  TITLE     trans-activation of the HIV promoter by a cDNA and its genomic
            clones of human herpesvirus-6
  JOURNAL   Virology 199(2), 311-322(1994).
   PUBMED   8122364
REFERENCE   25
  AUTHORS   Thomson B.J., Dewhurst S., Gray D.
  TITLE     Structure and heterogeneity of the a sequences of human herpesvirus
            6 strain variants U1102 and Z29 and identification of human
            telomeric repeat sequences at the genomic termini
  JOURNAL   J. Virol. 68(5), 3007-3014(1994).
   PUBMED   8151770
REFERENCE   26
  AUTHORS   Thomson B.J., Weindler F.W., Gray D., Schwaab V., Helbronn R.
  TITLE     Human herpesvirus 6 (HHV-6) is a helper virus for adeno-associated
            virus type 2 (AAV-2) and the AAV-2 rep gene homologue in HHV-6 can
            mediate AAV-2 DNA replication and regulate gene expression
  JOURNAL   Virology 204(1), 304-311(1994).
   PUBMED   8091661
REFERENCE   27
  AUTHORS   Inoue N., Dambaugh T.R., Rapp J.C., Pellett P.E.
  TITLE     Alphaherpesvirus origin-binding protein homolog encoded by human
            herpesvirus 6B, a betaherpesvirus, binds to nucleotide sequences
            that are similar to ori regions of alphaherpesviruses
  JOURNAL   J. Virol. 68(7), 4126-4136(1994).
   PUBMED   8207791
REFERENCE   28
  AUTHORS   Lawrence G.L., Nicholas J., Barrell B.G.
  TITLE     Human herpesvirus 6 (strain U1102) encodes homologues of the
            conserved herpesvirus glycoprotein gM and the alphaherpesvirus
            origin-binding protein
  JOURNAL   J. Gen. Virol. 0, 0(1994).
REFERENCE   29
  AUTHORS   Qian G., Wood C., Chandran B.
  TITLE     Identification and characterization of glycoprotein gH of human
            herpesvirus-6
  JOURNAL   J. Virol. 194, 380-386(1993).
REFERENCE   30
  AUTHORS   Jones M., Teo I.
  TITLE     Identification and analysis of the transport/capsid assembly
            protein (tp/cap) gene of human herpesvirus-6 (HHV6)
  JOURNAL   Virology 197(1), 449-454(1993).
   PUBMED   8212582
REFERENCE   31
  AUTHORS   Littler E., Lawrence G., Liu M.Y., Barrell B.G., Arrand J.R.
  TITLE     Identification, cloning, and expression of the major capsid protein
            gene of human herpesvirus 6
  JOURNAL   J. Virol. 64(2), 714-722(1990).
   PUBMED   2153237
REFERENCE   32
  AUTHORS   Martin M., Thomson B.J., Honess R.W., Craxton M.A., Gompels U.A.,
            Liu M.Y., Littler E., Arrand J.R., Teo I., Jones M.D.
  TITLE     The genome of human herpesvirus 6: Maps of unit-length and
            concatemeric genomes for nine restriction endonucleases
  JOURNAL   J. Gen. Virol. 72, 157-168(1991).
   PUBMED   1846644
REFERENCE   33
  AUTHORS   Chee M.S., Lawrence G.L., Barrell B.G.
  TITLE     Alpha-, beta- and gammaherpesviruses encode a putative
            phosphotransferase
  JOURNAL   J. Gen. Virol. 70, 1151-1160(1989).
   PUBMED   2543772
REFERENCE   34
  AUTHORS   Gompels U.A.
  JOURNAL   Submitted (13-DEC-1994) to the INSDC. U.A. Gompels, Viral
            Pathogenesis Unit, Department of Clinical Sciences, London School
            of Hygiene and Tropical Medicine, University of London, Keppel
            Street, London WC1E 7HT, UK
  REMARK    (1-159321)
REFERENCE   35
  AUTHORS   Tweedy J.G., Escriva E., Topf M., Gompels U.A.
  TITLE     Analyses of Tissue Culture Adaptation of Human Herpesvirus-6A by
            Whole Genome Deep Sequencing Redefines the Reference Sequence and
            Identifies Virus Entry Complex Changes
  JOURNAL   Viruses 10(1), E16-E16(2017).
   PUBMED   29301233
FEATURES             Location/Qualifiers
     source          1..159378
                     /organism="Human betaherpesvirus 6A"
                     /host="Homo sapiens"
                     /isolate="U1102"
                     /mol_type="genomic DNA"
                     /country="Uganda"
                     /db_xref="taxon:32603"
     repeat_region   1..8089
                     /rpt_type=DIRECT
                     /rpt_type=TERMINAL
                     /note="DRL; contains pac1 and pac2 sites; left end
                     imperfect tandem telomeric repeat array, right end perfect
                     tandem telomeric repeat array; direct terminal repeat with
                     DRR; can mediate DNA cleavage and packaging into preformed
                     capsid"
     gene            501..2653
                     /gene="DR1"
     CDS             join(501..759,843..2653)
                     /codon_start=1
                     /gene="DR1"
                     /product="DR1"
                     /note="DR1L; direct repeat of DR1 in DRR; contains CXC
                     motif; DR1/DR6 gene family"
                     /db_xref="UniProtKB/TrEMBL:A0A2N9DYY5"
                     /protein_id="SPC53468.1"
                     /translation="MPLTVRAGHAPYRLPLSNYWWLLLGRHSLRHVHSYLRLHKGLRI
                     PLPWPEQECLHLHPKPYKCLLRYPCITRQPHLLQGWPTKSSLWFDPKPYHPSADSKLL
                     PLGLITLSACSTRVSATTRWSSFHATDPSLSWLTGSSPWLVILQGQGGSLFCHDVLQG
                     RLYILSHSVSLFLKTGLRHCEAIYRAPLWRDRPLPSLWTCRDPDKAFLPTLLARSARR
                     GLAAFYALWRLHLGSRSELSHPVLEWESTELVLTDWRRGRNEAQRDAPSVAEHFARCR
                     PLLDELCGEGGWLPFAFLSTSPHVWLILTEGGPVLAVDVNDTSVWRIADDLELLRRLG
                     SLLLLSGLRLPLRPPSGSGEAAGEPGYEEEERRGRASTASATAATSTRGPTRPTRVTR
                     KGRVATGGVHLSARPESEEQTDGHHGRQESSDDHQRGGSGRGHRDDGAHRHANDKTEP
                     QQRGEHEERKQTDSGRHEHAQESQVARRDEEETEQGDSERSCGGATQTYGGRGRHDSC
                     PSIPLSVPGPDPRLWVPPPHLLFPSPLPPMTPVDDEPSVRPRCPPGPAEEPPTCRPRP
                     PRPSSDTPLSAVSRPSAPPVPPPSTARVRFFLSSSSSSPSYSPAPLSPPSPVSPSSPR
                     SPFIPPIRSPGLRAKPRVSSGHPAAFPPAPSSAPARSERVTSVPSSASPSASCVGKSQ
                     PPAAHTA"
     gene            4725..6702
                     /gene="DR6"
     CDS             join(4725..5028,5837..6702)
                     /codon_start=1
                     /gene="DR6"
                     /product="DR6"
                     /note="DR6L; direct repeat of DR6in DRR; DR1/DR6 gene
                     family contains CXC motif"
                     /db_xref="InterPro:IPR003360"
                     /db_xref="UniProtKB/TrEMBL:A0A2N9DYZ3"
                     /protein_id="SPC53472.1"
                     /translation="MSTRHTQRTGGRISVRRNEARLAHARARARFDWLLLARGRPSKL
                     YGYASRHRGELIHLPWPPCWCLELHHDPYRDARSATVWGHRWGWPATHVRPRCVQDCA
                     LDSCLYVCCGYGEKLQPVGFVKSYVTNSQLDTLRVLLVGKDGAVYVHHMRAARLCRLA
                     SSTTEFTRRGLQRDAVTYEEDLELPDQRMCGTNARHLFDVIAAAADEHNLLTVGGLCQ
                     THAGVSCNLLETVGDPWTAVPAARMTLTVPQVQYRLWPEARRDLRRHLYAGHPLGPWL
                     VCGVLSRERETQKPSPPIRTTVGNVPTPGPREVEIAWVVLTLAGPLLAFWPDTGKICR
                     LANSFSTLWKMGPRAMRGHWTYSAPGRHLPGDAWPLCEHVRPQVGKLPRKRAYLD"
     misc_feature    8090..151288
                     /note="UL; long unique sequence"
     gene            complement(8712..9812)
                     /gene="U2"
     CDS             complement(8712..9812)
                     /codon_start=1
                     /gene="U2"
                     /product="U2"
                     /note="SHL1; similar to HHV-5 UL23 tegument protein, HHV-5
                     US22 gene family; US22 like; Region: US22; pfam02393"
                     /db_xref="UniProtKB/Swiss-Prot:Q01349"
                     /protein_id="CAA58429.1"
                     /translation="MFCGSPFLGISSWSLASAALCPPSCSFSAGRDLRCDAEVPEVKW
                     TAFVRTLVTRPLSADDVWDFVSTFAHCRLALSWPVGAELRFATSDMLGITQAEVAKLS
                     RRYGCCPGMDLTVIGVTIFAEVSALVLVGECGEIYAFNGVFDDALYRLAEDAFGLWKH
                     GLRRFEPVYGSKCLTETGASFFGGMSGVDDVLAFAVSFDKALVPLPWPRGAFFEFAVP
                     GRPEKRWRLIPGGGVAVVIGRFFGRGVTSPLLRRQRVLMDQVGRVYAASLDGGAVVRL
                     SDSFRAFLAMGVRKLFKNHRFPPGHLWTMQLPVTCVHAPVIDLPAVYQLSPHMVERGM
                     PVASCEASTVVRGDCEETETEESTSGDSVLVC"
     gene            complement(10151..11272)
                     /gene="U3"
     CDS             complement(10151..11272)
                     /codon_start=1
                     /gene="U3"
                     /product="U3"
                     /note="SHL2; similar to HHV-5 UL24 tegument protein, HHV-5
                     US22 gene family; US22 like; Region: US22; pfam02393"
                     /db_xref="InterPro:IPR003360"
                     /db_xref="UniProtKB/Swiss-Prot:Q01350"
                     /protein_id="CAA58430.1"
                     /translation="METTKNRRVRFTGGLHEPAQDSTMCGNAELQSRERTKTRQRVYN
                     ESKRDLVDLLRVYTCLNSVRMFTFVNFGRRIPLAWPEGYQLVINNCRDENEYADEKLD
                     ELAGLVCCPERLVVLGYVKKRGGIGSEPCYWFSKGDIVVLLGGAGRVYAHTWLLPQQL
                     CRVGDTIDDFLRKGLKRFYYAHQLVSSLQFVVEDPEVDGVRSCRDVLCFRDRHIGRSF
                     ALRWPKNETLLFHRRRDSFAFVMCDEARRRLAEMCFFGSFGYKYFGDEGRISLYVADD
                     GQIFGFNDNDEDGRPRFVAEDFQQFRRIGVTQYYKSYVFRREQPEWALLPTCHLSRMF
                     YQKTWRQADADVLFLIARNDERNKFPDAGTRSAVHDVVR"
     gene            complement(11481..13088)
                     /gene="U4"
     CDS             complement(11481..13088)
                     /codon_start=1
                     /gene="U4"
                     /product="U4"
                     /note="U4/U5 gene family; SHL3; HHV-7 UL27"
                     /db_xref="UniProtKB/Swiss-Prot:Q01351"
                     /protein_id="CAA58431.1"
                     /translation="MELLDHDIYKGPVRERVTYTIPNHPYLSLTVHHSRELDVDLKDI
                     TEEMIIDSGTLTAEDLFMTRGLRFCDDSVLWAALAEKVSVEFQRRGKTTMDLSAFMSL
                     LERLTFEDETSVFYRLLTKCTALAHFSILEYIVDGEKRDTISAHFNRLLELLDSLFLQ
                     FLMLRNRSESNTLLTLFDILPNPKEIYGDAASPTSVLLKHFLSDHIFVAYASSYRFVS
                     SVLCSCDQCRASLFRIYLGKKDSRAVHISDISEFDPADLILGQLHLDAREAVALRAEI
                     DRDLGSSLILNSMERRHLPILHDKQLGRGHFERNILKVYCNIVLCLFLLRRVKQRIVS
                     DLTAIARFFVKAISEMERCIDTVSGLRGVRIKLLVVSSQFEIKDPMRVPRLCFFFLEI
                     VAILVSGYDKERHRVRALLEHLCLKKICLGDLCASMRLAREIRHDVLEGFLNTLELSY
                     MSNPVRFFRFHDCNLYGTHMWSGVYPNVVPYAVRGGGSFDIRLQEHRRRQKRIVVRRR
                     LIRRVQQRGLDIREARRVPKPACVTFI"
     gene            complement(13210..17087)
                     /gene="U7"
     CDS             complement(join(13210..14854,14944..15919,16025..17087))
                     /codon_start=1
                     /gene="U7"
                     /product="U7"
                     /note="SSL2; similar to HHV-5 UL28, HHV-5 US22 gene
                     family; US22 family; exon 3 is related to U4; US22 like;
                     Region: US22; pfam02393"
                     /db_xref="UniProtKB/Swiss-Prot:Q01353"
                     /protein_id="CAA58434.2"
                     /translation="MDLEAKEISGNIPNENALAELCRLCESADLSQIENFVGRYKNWC
                     LSIIWPRNCWLRFTPRKDVAGYTEKMFEDMDDHYQGFVEKLCLLGTIQIPYRDVPILI
                     GRSKRIFLHDLETDTLHFVCDNFEQFVRYGVLGTNIITCAEPVYRHGLYEGPRFESLE
                     NLMNNDVLRSPYTLNVHVKLNRKGVLGIKAMRKHYIAMLREFDELARCASLDDVGRFV
                     SLNVGRDLRLDMPVFKSLTLGTRDSVWTGTCRLANLKEQEDLVEKVVVLGYLNDHDYE
                     SKCTRPILCIGKSGKIYYYDWIDNVLVKLGDCLLTFLRVGFARLFADYGYEKIGKISM
                     RFGRMSTLGMSETYQSCMSLKIVPVCNDEFALSSCVPTLDFDVDVLSAAYGDGLEISS
                     PGLRCCIAWPPMYALTLGEFYHFHTHRWVSAYDWSSLLDADEFMSAVGYAHPIYRDPN
                     PDYDPYVMHTSTGKTIAVDTVTEKVYIIAESLVQFFNIGLRQFPPFAEAELDPEQEKM
                     WFGETKCGREEFILLQRNLPAMKDYVAKHSGKRIRVDAFQDFDFSFCSLSDIYYLTGP
                     GILEKITEKDYAIIGTCARSQAEPNCRAAIVMGSNCHIYIYVENKISKVSKSLRTFIR
                     RGFDELLYKEKYSLDWSDDTLFYISDTETENLNRMLNGELPVLRSKPRHMCVRKDRLV
                     KDRSKILFAVRLDEEDSPTVKFITKFLTPVFVGRLPATNRFVVPVSRARLTNGLQGTA
                     AARFGIKGLHPSSDCLVWNILVDYEYETYKYPSTYIRADQIADMVKDLKFMDNFNEKW
                     QCITKLAFLGLYAGASLFNFTSKPTLGYWCRYLSEYASMLLFQFESKLKELTKESTRQ
                     LGGYNLCHWGQELKDCLENKSDVFFRYDFFERIESCLIEHFMLLCGCVECRRMFIMYN
                     KRGRKFDFGHSVRIQCFPMIGSIRLPAFLHLGEPYDVSLSSLIAKDLGLSMIEGQIEL
                     SRLPISLQISVTPDKKALLTFLTNIVFIVFVVNTLYRVINAELDIYYDLFTEEVGKLC
                     VAMEEEMKLGRNGCLGDLCYFSPMKQMKEIVRCPGEKSQFILKCWEALRIGFSVPAYK
                     DYDETPFMEMFFMHHLHIKRFHEDNDRDLVSCDNLIPGFFIVNTDGENFLQRLQRVVL
                     PVVEDYLTNTRCINGTMAFFFSGLKYFGSGNHRGFQISPEKDVRAIAYKLGSLDVLRD
                     DYKYYEYTPPDCPGELNGHGGDE"
     gene            17600..18963
                     /gene="U10"
     CDS             17600..19111
                     /codon_start=1
                     /gene="U10"
                     /product="U10"
                     /note="SFR1, PIRF0; HHV-5 UL31"
                     /db_xref="InterPro:IPR007578"
                     /db_xref="UniProtKB/Swiss-Prot:Q01348"
                     /protein_id="CAA58437.2"
                     /translation="MEIVTYKTVSARSPTVTWSSGFGRAIASIQKRNQDNIRKPLRFY
                     TGLLHCLIKQYEHCLVPPNKSIRFDKGKIEVAALILDLGHQVLGRQIHVRQRIYSWTS
                     ITLPKLFTPKELYFLIASPEEENIAFNPTITKGGWISGSFSYPVDYRSNFSLTGMSAN
                     ILMVPFVPYKYPLNYARFISSIDLMILNEQFPEHECGDIQILKQRNYLYLGVIKNLTW
                     KKSVTGTGQTAPHRILKASFIGSWPDTSLPDRVALRFFNNTRFTIHCHEFSINIENLG
                     LVKNKEKVFGTLATVCCEQIPSLLTTENLPKYLIVQFEVVTQIEEPEPLLFSSNPKLY
                     FTGDVLNATIQLQHNPNYYELLVHAPYDIHFYPSRCHIVILPIRYFTKPDKQILISGY
                     QNEGFFETQVMLWAPGTPLHITLRSFSPNLILPQSTPIATLFYVERMTSQNNEQKDVI
                     AKLSENGHFIGNLKLPRENFLHHDAIADSPLASISKDSATPGPETVFSSVSPS"
     gene            complement(19015..21627)
                     /gene="U11"
     CDS             complement(19015..21627)
                     /codon_start=1
                     /gene="U11"
                     /product="pp100"
                     /function="major antigenic structural tegument
                     phosphoprotein; binds capsids"
                     /note="PILF1; HHV-5 UL32"
                     /db_xref="GOA:Q00701"
                     /db_xref="InterPro:IPR010340"
                     /db_xref="UniProtKB/Swiss-Prot:Q00701"
                     /protein_id="CAA58438.1"
                     /translation="MDLQRHPIPFAWLDRDKVERLTDFLSNLERLDNVDLREHPHVTN
                     SCVVREGDDVDDLKTLYNLLVLWLMYHYVLSKRKPDYNAIWQDITKLQSVVNEYLNSK
                     GLNKGIFENMFTNKEKFESQFSDINRALLRLGNFIKWGSNVAIDTPYVNLTAEDSSEI
                     ENNLQDAEKNMLWYTVYNINDPWDENGYLITSINKLIYLGKLFLALTQSWSKLEKVAM
                     SQIVITQNHLSGHLRRHDNFNIVYSHRVLQTPLTGQRVESFLKIITSDYDIIKSSLES
                     HSASKAFSMSEIGPNSLMDFVPLRGDIHSNLTLPSMSIDTKKSSLDPARLKKSNSRSL
                     DSFLRMQRQPKFLELDSVDNAGEKILLKEATLGGENVKATTPASSVSLMSGVESPSSF
                     TSTNLDLPLSSFTSTNLDLRDKSHGNYKIGPSGILDFNVKFPPNAQLNTNGVDLLQDK
                     TSIGSPSSGITDVVNGFANLNLHQNKSNVSPPWSRNTAANADFLDPVHRFVPEQTGTP
                     FVLNNSDVAGSEAKHTTYSTETGVSPRNVFLIKDLRGKDGFRKQKQSDIPKSLTKERN
                     DKAIMHSREVTGDSGDATETVGARNSPALRKIKQANDFFAGLNKKNDRDVLRGGKGNS
                     KDLHSGGNAKKKEMSGKFNDDKEMTRNGQEPSRSLMGDARNAGDEQYIQAGLGQRVNN
                     LLSQFTNLISLGEKGIEDILQNQRGTELKLATENKSGRESEEANVEKILEVSNPQDMF
                     KNFRLQNDLDSVQSPFRLPDADLSRELDSASFKDALDLKLPGNGEREIDLALEKVKVG
                     ETETSDLKVGQDESFVPAQLMKVETPEEKDDIIEQMVLRIRQDGETDENTVSGPGVAE
                     SLDIEAKGESAIAS"
     gene            21729..22861
                     /gene="U12"
     CDS             join(21729..21761,21851..22861)
                     /codon_start=1
                     /gene="U12"
                     /product="GCR"
                     /function="G-protein coupled receptor; like CC chemokine
                     receptor; inducible signalling"
                     /note="PIRF1; unspliced ORF U12; similar to HHV-5 UL33,
                     US27, US28 and EBV-induced EBI1; similar to all GCRs"
                     /db_xref="GOA:P52380"
                     /db_xref="InterPro:IPR000276"
                     /db_xref="InterPro:IPR017452"
                     /db_xref="UniProtKB/Swiss-Prot:P52380"
                     /protein_id="CAA58440.2"
                     /translation="MDTVIELSKLLFKGNASCTSTPTLKTARIMESAVTGITLTTSIP
                     MIIIVVTTMILYHRVAKHNATSFYVITLFASDFVLMWCVFFMTVNRKQLFSFNRFFCQ
                     LVYFIYHAVCSYSISMLAIIATIRYKTLHRRKKTESKTSSTGRNIGILLLASSMCAIP
                     TALFVKTNGMKKTGKCVVYISSKKAYELFLAVKIVFSFIWGVLPTMVFSFFYVIFCKA
                     LHDVTEKKYKKTLFFIRILLLSFLLIQIPYIAILICEIAFLYMPQNTCFWLARVEILQ
                     LIIRLMPQVHCFSNPLVYAFTGGELRNRFTACFQSFFPKTLCSTQKRKDSDASEHDQN
                     SKSKASVEKNQPL"
     gene            22947..23267
                     /gene="U13"
     CDS             22947..23267
                     /codon_start=1
                     /gene="U13"
                     /product="U13"
                     /note="EFRF1; positional counterpart of HHV-5 UL34, but
                     much smaller"
                     /db_xref="UniProtKB/Swiss-Prot:Q69548"
                     /protein_id="CAA58392.1"
                     /translation="MAHAKKRVRRKLLTSTDDPILSNTFTMRPTSKIADAEIISREHD
                     YIASKTQTDSKKISPLSVILDKTVLFEFYGIGDNNEKAIVYPIDPDFLLCDSEHNCTL
                     SPFL"
     gene            23365..25194
                     /gene="U14"
     CDS             23365..25194
                     /codon_start=1
                     /gene="U14"
                     /product="U14"
                     /note="EFRF2; similar to HHV-5 UL25/35 gene family,
                     tegument protein"
                     /db_xref="GOA:Q69549"
                     /db_xref="InterPro:IPR006731"
                     /db_xref="UniProtKB/Swiss-Prot:Q69549"
                     /protein_id="CAA58393.1"
                     /translation="MVTHAMEEPKTFNIPTFVLDENCNFIPEVLSRANAKYIKDVLIQ
                     DSYNTVCLANSFIPMTIQTAEQIMVIITKFKFSRARDLFEKVLRLGVHINRFYAGKKQ
                     VKHMITMMKSLFDTEEAMRRLDRALMGLFVDARGSSYMPLIALSLHENGLPDSKFTKA
                     VKLINTTLNSFHNRPDADIEQYAQKLRAYNYLYKIPHYTLKEAVDVYSENLKDLSIGV
                     NKKPTLLFTSSDDGYLSHIFNDMLFLTSTWNMIYNCKVQIRRLTTWIKYEINSIVEDC
                     VLVGFQLPDLKDTILDLAALTSNMNLVDPDKDLFSHYKLILEKLFEISIFATKANICI
                     LPTFIKSHLIEFEDVLKRSNDDEDLNYLLLKSNDSDDEYDEDKLPIQVDPGRVDNVLT
                     DSNFFNVTADNAFSSIAIMPISYDKIIDVEENVIQVLEVEMQSLSAVVYGAVANKYGL
                     SLPQVIKRLNQNEGRASSRASSSHSTSTIPYSPPQSGRSTPTSILRQRAPIRSNSRSS
                     SVSFSQDDDNRSHYSDETNISDYSYPMADLDLEDEEPMEDHPHSPQSASSNNSMSRRS
                     RALQNEQRRRTPTMAPPSPARGQNNARLRRRTRRSTETNDERL"
     gene            complement(25228..26041)
                     /gene="U15"
     CDS             complement(join(25228..25413,25579..25651,25725..26041))
                     /codon_start=1
                     /gene="U15"
                     /product="U15"
                     /note="EFLF3"
                     /db_xref="GOA:Q69550"
                     /db_xref="InterPro:IPR008644"
                     /db_xref="UniProtKB/Swiss-Prot:Q69550"
                     /protein_id="CAA58394.2"
                     /translation="MDVWKRQRLQECRELCPLPVLMSLSNMFSKIEIVYVKYLFKMDF
                     STMYRYILPALTLSMTVTKSLVIEMLFILKRWEDIDQFFRLNIRKVNDCFIVAQFNHI
                     PIKRKLIVLLYMLTSRQEKQLFLNMIYAFLEKSHLRLGDDEEQNAIRFFSYVDDLHLT
                     RDILLEMIHKLKNTEINQTMELLLSYNELAR"
     gene            complement(26308..27398)
                     /gene="U17"
     CDS             complement(join(26308..27083,27170..27398))
                     /codon_start=1
                     /gene="U17"
                     /product="U17"
                     /function="apoptosis; inhibitor of caspase-8-induced
                     apoptosis"
                     /note="EFLF1; similar to HHV-5 UL36exon1, HHV-5 US22 gene
                     family; ORF contains U16 exon1; region IE-B, immediate
                     early gene; US22 family; pfam02393"
                     /db_xref="GOA:Q69552"
                     /db_xref="UniProtKB/Swiss-Prot:Q69552"
                     /protein_id="CAA58397.2"
                     /translation="MADERTSDSVKTRYDIALMKLNDIKIAVFRDSLSTYVEQKTGLT
                     IQFNWPKSRCLVISTLCKIPFPTKSAAELQEMCSLLLCCPERLQLLGYVSVWGEETRD
                     VCLTKTLVFAGEDEKFYGLDFVNETLYLLAETTERFAVLGLRRYDPVYREKDIRFLTK
                     IDDVLQSLIDAQDNLWKFATIVYKNSGRHYIMKSCLENNDGVFVLFLTRKEDFPSRME
                     WNFFSDVYESMPYDGQVIGSIGKTLLYPKTMFVMMDLSGAIYGIDTIGTGIGSCVKIA
                     DDFESFLRQGIVRGYRRYKFFHRNINTVQEILPLCPHTSLGPTFSNNYIYDLSSEDDE
                     "
     gene            complement(28557..29438)
                     /gene="U18"
     CDS             complement(28557..29438)
                     /codon_start=1
                     /gene="U18"
                     /product="IE glycoprotein"
                     /function="glycoprotein"
                     /note="EJLF6; similar to HHV-5 UL37 exon3 immediate early
                     gene, HHV-5 IE glycoprotein; region IE-B"
                     /db_xref="GOA:Q69553"
                     /db_xref="InterPro:IPR010880"
                     /db_xref="UniProtKB/Swiss-Prot:Q69553"
                     /protein_id="CAA58398.1"
                     /translation="MKKLTMESLSVYIFVMGVCFTSNFTCEQKIVLIQEHKLRSICIS
                     TCYVNGVLAGNSSCVSVKTSYLINLAMLTNGFKAMRVGNITSISEKTAFLRVIINYYF
                     RGVMLRALIAQRLPNAANLSSTVNCWLDDHSAGGVMTLFYGTERIVLNSSTEINASRW
                     ISDGQDANGTLNILNERVSLDIYFLSKICPQLSSEIYKKKVAHPKYFSLIKNDTKPKK
                     FLRNTWRSAWSNWYKYKEIKEFLDFSSDYENFSEITYSMSAAGLFFLAGGAFTMLLLL
                     CCLSMITRKHIVKDLGY"
     gene            complement(29698..30867)
                     /gene="U19"
     CDS             complement(29698..30867)
                     /codon_start=1
                     /gene="U19"
                     /product="U19"
                     /function="gene regulation, transactivator, inhibition
                     apoptosis"
                     /note="EJLF4; similar to HHV-5 UL38; region IE-B; US22
                     like; Region: US22; pfam02393"
                     /db_xref="GOA:Q69554"
                     /db_xref="UniProtKB/Swiss-Prot:Q69554"
                     /protein_id="CAA58399.1"
                     /translation="MAFTGDELARMLQFKDKMISSAGLALKFEKVVQEAMASGIVLQH
                     ITCIKVRICDNSDILSDRQLRSLLINGLYPFEGRMSMFGVTEEWEGASAAPERQVVFL
                     LSSTGQVLGYEDGVVFYLSPTFSDFWTTAMEFSCQNAILSNFIAQKSRDEYIDQFQKY
                     FTRMRHTPIFLTGVLPRRFQKVESSACVEEDARASMRPIQCDSFGVKDTFCRPTEELL
                     QPSANKDVGGKVCMSLSCREDNSARHCTIYGLTETRGIKIMFSRHTQTDRSEVMCNAA
                     TQTGDVVDNSSETLFLGKNLVHQSILETEVKTTAKNTFDVSNPRIDSVYDTTVFGAMA
                     TDDVGCENVQGGASLAQEKPLKGYCITATPSECKPNIHWLKSPEKTVQESAAVLR"
     gene            complement(31118..32386)
                     /gene="U20"
     CDS             complement(31118..32386)
                     /codon_start=1
                     /gene="U20"
                     /product="glycoprotein"
                     /note="EJLF3; immunoglobulin superfamily domain, C chain;
                     similar to HHV-6B U20; inhbition TNFR signalling and
                     apoptosis"
                     /db_xref="GOA:Q69555"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR036179"
                     /db_xref="UniProtKB/Swiss-Prot:Q69555"
                     /protein_id="CAA58400.1"
                     /translation="MITVFVACLFQCVSSLPAKLYIKTTLAERIGKLQTVIGIDNDIV
                     FAYERLYEDLTLLNHTVVGETLFDLTGSLEEGKNSTVDRFLGHVVIREFHRLHAGLQY
                     VSLRNFSVSELVCFVNNNTQLSGSYVFLAGNTTYVQIDLFNENRGFVHDLINLSSFLQ
                     NRSLHVLSFYARRFCVEDILNFYGKVVFGDSRHRPPQVFSKRDTGLLVCTARRYRPIG
                     TNIQWSIQNQTVSDDHMTDDFIRTEIAGQLLYSYERALSRALSMTQRNFSCEITHKLL
                     VTPALLTREDAFSFKGFVNPVKQSEDMFPRHNFPAPHRKKFNKLQLLWIFTVIPIAAG
                     CMFVYMLTRYILFFVSGGCSLNPNRVLKRRRRNDEVPMVIMEVEYCNYEADDYMELHS
                     VQKVRDNSIAVVCGNNSFDIERQSKISRNF"
     gene            complement(32389..33690)
                     /gene="U21"
     CDS             complement(32389..33690)
                     /codon_start=1
                     /gene="U21"
                     /product="glycoprotein"
                     /function="glycoprotein, downregulates MHC calss I"
                     /note="EJLF2"
                     /db_xref="GOA:Q69556"
                     /db_xref="InterPro:IPR020177"
                     /db_xref="UniProtKB/Swiss-Prot:Q69556"
                     /protein_id="CAA58401.1"
                     /translation="MMICLVFLCVLTLARGEIYPPICPAPGVGNDEAVRAGELLLEIS
                     AYRNQRSGRVELWGSAAVNNQVFYGGMENSQIDYDFGKFLVFRCFQVFNNVHKLLFNT
                     VSSATMHLARKRVQKCGHGKMTFISIQVQCSVNKKSIRLSRMSEASLKKQVLRVAFFL
                     DRNNNSWIADKNFQGEDRTMLRLWNELSTYQQYLISSCNNDVKILSELYGEFRQIALP
                     YDEKLNLNFMPVIRSSSERLFRADDLKCSFSRWLGAEGEFAVCEYSGWGVSRLGKIEI
                     FAEKPLTFDMAWKTVKMRSSGAYTSLFRDDVTWGLIPLDKWVGDKYFCMCTNKESGDN
                     VIVTLPEKNVEKSIQIYDEGSAMLSFAEMTSIILNLMFMGAVAVSVGILGISCFVGLK
                     EIIYFIFVSVDYMWPFCDTLLTTAVNCFFKGRTFLRRELKI"
     gene            complement(33788..34396)
                     /gene="U22"
     CDS             complement(33788..34396)
                     /codon_start=1
                     /gene="U22"
                     /product="glycoprotein"
                     /function="glycoprotein, late gene"
                     /note="EJLF1"
                     /db_xref="GOA:Q69557"
                     /db_xref="UniProtKB/Swiss-Prot:Q69557"
                     /protein_id="CAA58402.1"
                     /translation="MVPQGCSLVWVSALYVSVIASLHIINNENSVFIATHSETELRHW
                     LIFVKMAQRNGTAWWRMASVPINAYFERDIAFLFNPRCVIETAMGSKILCRYNKNIGV
                     VFVDNDTKCNVSFPSGVQLQLLNQSVMESIRTKTYVVDYARKTTERGDCFISVAFCRK
                     ERRRFLSRCERFVYYCISVYLFAVVVLCSCWFALDPLFNMWA"
     gene            complement(34424..35134)
                     /gene="U23"
     CDS             complement(34424..35134)
                     /codon_start=1
                     /gene="U23"
                     /product="glycoprotein"
                     /function="glycoprotein"
                     /note="EqLF1"
                     /db_xref="GOA:Q69558"
                     /db_xref="UniProtKB/Swiss-Prot:Q69558"
                     /protein_id="CAA58403.1"
                     /translation="MLFLSFLLVCLCEEVRMLNLMTTEVSATEFASIASKNMETDVST
                     SSDYLTGKSETTFSANSETWGKNVTEISIDSETYLNQSFMVTSTLAVETTDRSIGNNV
                     NVTSSFPTVKGDETQNIETSFTVISASTFSDVSEKTPQGLSTKSTPKKTVQALWETDT
                     VQVLEFTDTHEGDEEYFKDFLSSLVIWIGGISFIGAFVILIVILCNWYKKDKQRSLFW
                     DEEKKPDVQMRRDVKTCR"
     gene            complement(35441..35704)
                     /gene="U24"
     CDS             complement(35441..35704)
                     /codon_start=1
                     /gene="U24"
                     /product="glycoprotein"
                     /function="inhibition CD3/TCR recycling"
                     /note="EoLF1"
                     /db_xref="GOA:Q69559"
                     /db_xref="UniProtKB/Swiss-Prot:Q69559"
                     /protein_id="CAA58404.1"
                     /translation="MDPPRTPPPSYSEVLMMDVMCGQVSPHVINDTSFVECIPPPQSR
                     PAWNLWNNRRKTFSFLVLTGLAIAMILFIVFVLYVFHVNRQRR"
     gene            complement(35723..35896)
                     /gene="U24A"
     CDS             complement(35723..35896)
                     /codon_start=1
                     /gene="U24A"
                     /product="U24A"
                     /note="EoLF1; contains a potential transmembrane domain"
                     /db_xref="GOA:A0A2N9DYZ0"
                     /db_xref="UniProtKB/TrEMBL:A0A2N9DYZ0"
                     /protein_id="SPC53488.1"
                     /translation="MLLISKTLFPIPRGADEFWEGTYILVVAFVLAFLVYSDFLSNLS
                     PFGEILSSPCIST"
     gene            complement(35913..36863)
                     /gene="U25"
     CDS             complement(35913..36863)
                     /codon_start=1
                     /gene="U25"
                     /product="U25"
                     /note="EPLF3; similar to HHV-5 UL43 tegument protein,
                     HHV-5 US22 gene family; US22 like; Region: US22;
                     pfam02393"
                     /db_xref="InterPro:IPR003360"
                     /db_xref="UniProtKB/Swiss-Prot:P52527"
                     /protein_id="CAA58405.1"
                     /translation="MGLSSSKDIDLLVNFIENRQGATLALPWPEDYRLTLHSVENIPE
                     ISREDVQNWAKTYMCCGGELVVVGVIHKAKTRTCRGPIVLQGARGHIYVYNGFFDRSL
                     YHVASSFHDLFSNGLRFFYPIYETCDYALDSTVALDMIAHSKSFSELLHYRNERKNAF
                     FTLKTYPYKTFVRFCNLSMTEFSSRHLIQWRRKLQTSLLDVVFIVQHNFFGDWRELVV
                     VFDGHGMLFCVDREESLLFIARNMSDFLKIGCLRYNENRRLHTQWFTQDTDYIKQVDE
                     MFSRDVLCPLREHCQRSRRERGLLKICTSLVRGVNCIERG"
     gene            complement(36971..37858)
                     /gene="U26"
     CDS             complement(36971..37858)
                     /codon_start=1
                     /gene="U26"
                     /product="U26"
                     /function="possible membrane fusion"
                     /note="EPLF2; type 3 membrane protein; 9 transmembrane
                     domains"
                     /db_xref="GOA:P52444"
                     /db_xref="InterPro:IPR009980"
                     /db_xref="UniProtKB/Swiss-Prot:P52444"
                     /protein_id="CAA58406.1"
                     /translation="MRRLTDSFILGLAKGAVIPGLYTFRMTEGRSPLGQIGVLITVAI
                     SFLLTFKRFDPRFYKPIGDFKIVFLSLMAPKLPSLLSAVVMICLIFSEMRLRMILSRC
                     VMIMPSYSPAVFTGIMVSLFFKSQMFDDYSVLITAASLLPITVRYGWMIRSSGFLLGL
                     QKYRPILKSTSFREVDLKCLVKFTVEFLLLFTMLWIGKMFLSMPKSNHLFFLTVVNNV
                     FFKLNVFKAAACAVVAILSGLMMNVCLYRIIFEAFVGLGFSSIMLTLSSDLKDRSFYA
                     GDLLNGFFCLVVCCMYFGV"
     gene            complement(37846..39027)
                     /gene="U27"
     CDS             complement(37846..39027)
                     /codon_start=1
                     /gene="U27"
                     /product="pp41 transactivator"
                     /function="replication, ds DNA binding prtoein, DNA
                     polymerase processivity subunit; transactivation"
                     /note="pol processivity factor; EPLF1; pp41; similar to
                     HHV-5 UL44 (HHV-5 ICP36),HVS GENE 59, EBV BMRF1, EHV1 18,
                     VZV 16, HSV1 UL42; Herpesvirus polymerase accessory
                     protein; Region: Herpes PAP; pfam03325"
                     /db_xref="GOA:P52439"
                     /db_xref="InterPro:IPR004997"
                     /db_xref="UniProtKB/Swiss-Prot:P52439"
                     /protein_id="CAA58407.1"
                     /translation="MCWSFHLFFKAHKARVGARTSFLTEMERGSRDHHRDHRDHREHR
                     ETREPPTLAFHMKSWKTINKSLKAFAKLLKENTTVTFTPQPSIIIQSAKNHLVQKLTI
                     QAECLFLSDTDRFLTKTINNHIPLFESFMNIISNPEVTKMYIQHDSDLYTRVLVTASD
                     TCTQASVPCVHGQEVVRDTGRSPLRIDLDHSTVSDVLKWLSPVTKTKRSGKSDALMAH
                     IIVQVNPPTIKFVTEMNELEFSNSNKVIFYDVKNMRFNLSAKNLQQALSMCAVIKTSC
                     SLRTVAAKDCKLILTSKSTLLTVEAFLTQEQLKEESRFERMGKQDDGKGDRSHKNDDG
                     SALASKQEMQYKITNYMVPAKNGTAGSSLFNEKEDSESDDSMHFDYSSNPNPKRQRCV
                     V"
     gene            complement(39069..41483)
                     /gene="U28"
     CDS             complement(39069..41483)
                     /codon_start=1
                     /gene="U28"
                     /product="RR1"
                     /note="P2LF2; similar to HHV-5 UL45, similar to large
                     subunit of ribonucleotide reductase, but no encoded small
                     subunit; similar to HVS GENE 61, EBV BORF2, EHV1 21, VZV
                     19, HSV1 UL39"
                     /db_xref="GOA:P52343"
                     /db_xref="InterPro:IPR000788"
                     /db_xref="InterPro:IPR034716"
                     /db_xref="InterPro:IPR039718"
                     /db_xref="UniProtKB/Swiss-Prot:P52343"
                     /protein_id="CAA58408.1"
                     /translation="MKRKERRINKDYGYNRKCVCHYEASQKRFCYSQYSCASVLYERV
                     RDIAKIIDRLDSGLDAWCLRDAIISVLRATHCVPRVDRMLGRWYLKTSVFYDFCPDDL
                     ILSCPNVIMPNVLNFVKKYRDFIRSVLYKVSVSWKNQYMPGVLAASRFLEEISNSLNG
                     VEESIPCIYLRMCATLTEIVLRIGYLREIYQENPYVMFEELAFSLFTQKWVLPFSCMT
                     NLGLVEKANSTVFDVAIYNTCLYSLVDFTIVNGEHLFPALLNGSNISMNLTRYQQEAK
                     NIFEILLSQIRVVERDTDKTVQLTVYVEVWHVSALMWLDLYEALPQTSRVTFCLIIPG
                     IFMDRYELKRAQWSLFHKNIAFELGKCDEITFSTKYLEFERTTDHAKITMSSFIEKIC
                     LCLKGGRMGLIFRKNVYQYSMIPHVPLYCGGDFLDVLPVRDGINTCMRMLLNVVHFLG
                     DEVSDELTEEIDFVRLQCKFFMFNELRRVVRKMVLVANAVIDYAVENKDFLCEGIEDG
                     RSLGICVTGLHSVFMTVGLSYAHPDARRLYRMICEHIYYTCVRTSVDCCMKGAEPCNL
                     FDRSKYALGMLYFDHFDNVECTLPEELWTTLRKDVLMHGVRNIHFTAGTAMQKEFDII
                     NSSESFWPMEDNKILRRSNIKVVIGKDGLNDVTSVYSSELKSLYIPVYNNLLLNRFNK
                     HQQYLKTVGYRVLNVDTNLFTDKELDDLAVFKDGFSYHLNDLIEMYKSGLPFLDQGQA
                     NVFYFNDTVSLRLLLPLLYKAGFKVAMYKVLCNSEMYKHLDLSNPLPLIGKCSDGVVM
                     HVKNIL"
     gene            complement(41506..42405)
                     /gene="U29"
     CDS             complement(41506..42405)
                     /codon_start=1
                     /gene="U29"
                     /product="U29"
                     /function="capsid assembly and DNA maturation; capsid
                     morphogenesis"
                     /note="capsid triplex subunit 1; complexed 1:2 with capsid
                     triplex subunit 2 to connect capsid hexons and pentons;
                     P2LF2; similar to HCMV UL46 (HCMV minor capsid protein,
                     mCP), HVS GENE 62, EBV BORF1, EHV1 22, VZV 20, HSV1 UL38"
                     /db_xref="GOA:P52348"
                     /db_xref="InterPro:IPR004999"
                     /db_xref="UniProtKB/Swiss-Prot:P52348"
                     /protein_id="CAA58409.1"
                     /translation="MNSKSSARAAIVDTVEAVKKRKYISIDEGTLNNVVEKERKFLKQ
                     FLSGRQNLRIAARVFTPCELLAPELENLGMLMYRFETDVDNPKILFVGLFFLCSNAFN
                     VSTCVRTALTAMYTNSMVDNVLSMINTCRYLEDKVSLFGVTSLVSCGSSCLLSCVMQG
                     NVYDVNKENIYGLTVLKEIILEPDWEPRQHSTQYVYVVHVYKEVLAKLQYGIYVVLTS
                     FQNEDLIVDILRQYFEKERFLFLNYLINSNTTLSYFGSVQRIGRCATEDIKSGFLQYR
                     GITLSVIKLENIFVDLSEKKVFV"
     gene            41933..45181
                     /gene="U30"
     CDS             41933..45181
                     /codon_start=1
                     /gene="U30"
                     /product="U30"
                     /function="capsid assembly; virion morphogenesis"
                     /note="complexed with large tegument protein; P2RF1;
                     similar to HHV-5 UL47, HVS GENE 63, EBV BOLF1, EHV1 23,
                     VZV 21, HSV1 UL37"
                     /db_xref="GOA:P52437"
                     /db_xref="InterPro:IPR007611"
                     /db_xref="InterPro:IPR034738"
                     /db_xref="UniProtKB/Swiss-Prot:P52437"
                     /protein_id="CAA58410.1"
                     /translation="MTHDNRQLLPQETKLVTPNKDTLSSRYLHVLIIDNTLSTIEFVY
                     MAVKAVLTQVDTLNALEQRKNRPTNRILGLSTSVSKRYINIPKFSSSGASNSQGVKTL
                     AAIRKFCLPDKNCFRNFLSFSTTLFKVPSSIDIYFLFFTASTVSTMAARALDLEFILS
                     SLKNSTSPESLLAATAKIELLSLAADSVTHNRVIAFINRLTPKKYHFDLIRQYAVFYF
                     LNSTTLTSENKLLSAELLYEELSQIPSSSSSGTELENLNNAEVLYVFDRILNSIKMLK
                     NELSSPIGKLRAQPAANDPGTDKTIKYSKIQSIIQKINSFTHENSLLANCRAVVELID
                     DLYRKLYSWFLHVLTFEDIQFPGDTFLDRLLKMDYCFTYYPSSNRHLIDLFEKTLDNQ
                     TFTNLDKFFDTSGNSPELLYQKTFSLKIFSKNLTAQDNGLYIYPLLKTDLSILDFLGT
                     ENILFHRGLIYHILHQKTIPQERENDLNKINQFFATVIQQVIETKSSCLPASLSQLLD
                     TIFHFNRIGLNMETCRTYIEILSNHMATPDTQPIINTFTINLTHIVFTAHVFFICMEN
                     FSPTFIFYNRKKLILEQQRAILIIERNDYSTLWKQISDHIECLFNVSLSESFFKEYTK
                     GGNEDQKQFLYKNLFEKWGNVFFPFTYSVSTSNNSTAHHITTLELRDICKEVYQSDSP
                     DAYESLLPYSTHPSFKTLFVKIYVIPMVSHITNLTFDKLQSDCRLLTLIHACKLLLPS
                     QHLLLHYMAWLYAFSINVDHIDLGTFTVIKSVIFKIADHINVMTHTIYSPETNLLVSI
                     LLNAYTNYLQKYVNPWIKQTITANFSLIQTYITFTKQCASILATKCNINLDNLFIYIT
                     IGTDKIVTTSFCSFIATCRNLVRQHEEFEKSLQTIQISEITLTGMLRNIITSVSSSKE
                     LLTNEALQKFIDTVQRISQHVNETYHSISVNLEKCKTSNDILIESLKKIIYIVDVLSS
                     NAILNTSLASRCLEAANLAVSNNSFTILEIKKDAVAVFKPFITQLFESMKPTTSLHKK
                     LMSTQKLTTDHIPFLDTFDDRYNLVRHVERQLNWYAAHAEAAQQDLITPLKF"
     gene            45199..51432
                     /gene="U31"
     CDS             45199..51432
                     /codon_start=1
                     /gene="U31"
                     /product="large tegument protein"
                     /function="large tegument protein"
                     /note="HHRF1; similar to HCMV UL48 ( high molecular weight
                     protein, HMWP), HVS GENE 64, EBV BPLF1, EHV1 24, VZV 22,
                     HSV1 UL36"
                     /db_xref="GOA:P52340"
                     /db_xref="InterPro:IPR006928"
                     /db_xref="InterPro:IPR034702"
                     /db_xref="InterPro:IPR038765"
                     /db_xref="UniProtKB/Swiss-Prot:P52340"
                     /protein_id="CAA58411.1"
                     /translation="MKIITSSTNQNDSKYGPRAGKQCMSNSFSFLHTVYLNGINNSLN
                     AGTIDAIMEEGYHLDTAGTLALMLNNSDSQDYRLPTEIPKRIHSRYGVTQHELSRPFN
                     GTLDTQKIDNEVYLGLIDFILYGKSKNGPTFAVITIGVLSRALFFLNNTLYLFDSHPT
                     EREATAAIYICQNIEEVYELLTTHGTEGFYYDASLIFFIETSNLSLSSHDAELLILKT
                     YKDPDIAIALDKFSSTEIHEIKKTDDIGSQQDLVADKTTDLEHAPHKRKKNSHSLELE
                     LNDKKKKDTASLTYYATEVDLIPSFYELRSQFQSLFHDLKSFPIMKSNFNWTIYLQDS
                     PINPNQPFATPFLWNRVFHLLCQIIDVFVGVGSTNDDSSKQQQQTIFINYLLPFKDFS
                     EVFNEALAACQENNLDIIFIYNNYLCKTTTFRTLERILLSKFLAIVDNDHKKHYEWVK
                     SWTTQMFQGMPKKLDDIENYLKAYVDHNPVKHFHEFICLNKAEKYKVAVLLNEKRKEI
                     QEAIEREKNSFAQLSNFIDKLGETPALPIESENVHKVHTSDITEGIVPRFITESIELP
                     NISTLNNTQQISLDKQLNEKLTNTIHTLTNKFTKIVQDNYNNIAAGFMPVTELNCLFA
                     YLVNLYFNIEVLKHSGLNINTVLLQEVEKLYDNTQFLRFGTSHFNINNLSNFTLSIRK
                     MFVDFYNSQKPSDRASEILAAIESILADPSKNKTVVNIEMIKSQLEELGKMEISTTEN
                     KQTAAITKQILGDQELTPIYDFLHHLSAYNLPNTTTVKNLHLHFILEQRPDIAMTLHD
                     KIQSILDIYVDDMLNDITVPEQTFSTVLFLVDLFPNSTEKTALFESVLTLRQLAKKCA
                     NLKTLDEFDDLAQFITTNSEQLQNMMRQHFGKKIPTLMGHIKFLYSQKIITTEEKNWI
                     QRAKTVVITSPEELTAFLATAPTKHALQTCKPDLDKALQRHMEEQMKQTAENDKKHIL
                     TIRSTLEKRLTDILLILKDGQFSSLETMHLNLLETFLKQLQDNNVIIHFTHALLPVLK
                     DIETTISKIISDVIEKILIKTPLNPEQMSKEEQKYTPLLSFLSKFKKTTFCTEDVKTE
                     IEQVQKSITFLKKIATSTNKHTRLSHSIYGQELNLYEERITELRKETNKMKEQLSKEY
                     ALAEKKILLSSQDAKTDKIYLVLNTHTLKEIKNTQFKETAFAKALTVEVNNKENQLQE
                     LLNHFNAHLKAKMDQNHITKLSFDTKWTAFVSDSRLYIPDFINIKLQDFISDPFKVIS
                     QLMNKATNEMPYIQAEITLKWLTKLIHDINKFCLSAISEFGKEAIPFNYAALRDLEYQ
                     INTKYVEIENKVICNETVENTKNIPKLTKLLKQLDPKRVAGGQEQYQTLMNKILTSET
                     SMQQTYEKEQLKKEYFEIVNNVASFKLAFNFPQQLQNVERLIEKFKSLPKSQPFEKFP
                     QENDLLSDSLNTENYINGLRALLNFITAAQNYIQNTLLKQWAVFQQQNFIPIDYSVAN
                     VKPISDLYARLRIERERQVFYQVNSVFGTHLIVDDTGVPLQFHNIFNNAIVKFFSLNY
                     KQINVPEDTPRLVSSQYKLLSVCKSFIMILQQFWENIITLDLGPYLRDGTQNFKRELI
                     PIVNLKLFIYCITQAWTASEDSTVSTAFELPIKQFTLLILCSHPEYLYGCLSHSTDLV
                     INSLAKSIDKNSLYNTFVVSHNPPEKPMHLMRNICIDTQLWQPAKLMKDTFQQTFFTQ
                     LCPKNEKFFIYLTAFLILPYKFMNYIWIQYKPAIFTQRSYQNLIKDLCSEYVHQNKIT
                     TSSVTPHEPDTIKSGERITSKITVHKAQNTPTLTRLQAQEYVFDYILYSFLTGYEMTF
                     AMYIDIIEKTYLLCMRHLENVLHDKDFQSVLRARTFDIDYILKQSWTKNIVEHSLFSV
                     QLDKIVSYLNHTNRATPNIPLILFNYDNEVVNVYLPPMSTNPKKVAFYIKNPFHFPVQ
                     EYEATNLISFHLYPKTTDILNQLPPNNTESTRPGKQTSETLTNKNLSEPKFKKPAVTG
                     LMPKSQSIILSTDTNVPETSPDVKANTASAAIKDVTLAREKINEFSESINTTISKLKS
                     MYL"
     gene            complement(51504..51770)
                     /gene="U32"
     CDS             complement(51504..51770)
                     /codon_start=1
                     /gene="U32"
                     /product="U32"
                     /function="possible capsid transport"
                     /db_xref="GOA:Q69560"
                     /db_xref="InterPro:IPR031385"
                     /db_xref="UniProtKB/Swiss-Prot:Q69560"
                     /protein_id="CAA58412.1"
                     /translation="MTTIRSDDLSNQITQISGSSKKEEEKKKQQMLTGVLGLQPNMAS
                     HPVLGVFLPKYAKQNGGNVDKTAFRLDLIRMLALHRLNTKTGSD"
     gene            complement(51772..53184)
                     /gene="U33"
     CDS             complement(51772..53184)
                     /codon_start=1
                     /gene="U33"
                     /product="U33"
                     /function="capsid protein"
                     /note="XILF3; similar to HHV-5 UL48 (capsid protein), HVS
                     GENE 66, EBV BFRF2, EHV1 25, VZV 23, HSV1 UL35"
                     /db_xref="GOA:P52441"
                     /db_xref="InterPro:IPR004339"
                     /db_xref="UniProtKB/Swiss-Prot:P52441"
                     /protein_id="CAA58413.1"
                     /translation="MFYLKKLLRQLLAPLCKHGSYTHLQLFVMGEACVPGKCVLTMFL
                     TNKKFLNKEVTEKFYNEFFAIWLRCRPETRLITKRLFNKMVMTKGLFVLLAYLYFVYR
                     QCKVLELLSLYKLKTIKWVDVETRFRVYPPYKLNKLLEMPSFSEINELHMFLFEQQLL
                     LPIPTHVNLPCMRLFCLRDYEQTETVMLRYRQREHVLSFPSMLRKYALKSPAGNFMFT
                     MAKALVENFCFSADRYLIPVEHNNLVPMVPSKPERGDFPKILTFALATSLKDGLATSV
                     ISLPVMCYCKTKCSRFILEESYICVICAKCGHCLNSGKEKLCSPQGFSLSSMFYFRDK
                     QEKNLIYSMHTDVMYCSLCGSQQLVFERIYEMSEHCVLGMKVKTVSWKAVIGTNSACT
                     ILNDNVKFDVIVPCSCRSCYSTVHLYNVTVKKLLRLVSHGSDFQCQRCQHSFRETCLD
                     LEDCVNICQGCQISQNVRCI"
     gene            complement(53135..53965)
                     /gene="U34"
     CDS             complement(53135..53965)
                     /codon_start=1
                     /gene="U34"
                     /product="U34"
                     /function="provisional nuclear egress membrane protein;
                     virion protein?"
                     /note="type 2 membrane protein; interacts with nuclear
                     egress lamina protein; XILF2; similar to HHV-5 UL50, HVS
                     GENE 67, EBV BFRF1, EHV1 26, VZV 24 (?), HSV1 UL34 (?)"
                     /db_xref="GOA:P52465"
                     /db_xref="InterPro:IPR007626"
                     /db_xref="UniProtKB/Swiss-Prot:P52465"
                     /protein_id="CAA58414.1"
                     /translation="MANVLKEKMYDELLSATCRILKLGSHDYRITERNLLSKNPKFPL
                     CDIILKLDYAYNLEYLLSLWEHVTKQEPRFVFKNTGGAVSMSCYLHAPVKVEGHHAVR
                     ECNILRVNECLTVRMSDIVAMKPSTFAVFTKCIIRRNRDDTYVVEFVAFGPENESEYI
                     SLLKAIFLKKCSMGKQHLESNRFCQGLRRRSSHVLEKGRFESSGKVVNKASAVVTSQE
                     SIKQFYEKEKSLLSGVKFWRLSERHCRFALVGICFLLALYFCYVLLKKTPTPASGSVV
                     "
     gene            complement(53982..54302)
                     /gene="U35"
     CDS             complement(53982..54302)
                     /codon_start=1
                     /gene="U35"
                     /product="U35"
                     /function="DNA encapsidation"
                     /note="similar to interacts with DNA packaging terminase
                     subunit 2; XILF1; similar to HHv-5 UL51, EHV1 27, VZV 25,
                     HSV1 UL33"
                     /db_xref="GOA:Q69561"
                     /db_xref="InterPro:IPR005208"
                     /db_xref="UniProtKB/Swiss-Prot:Q69561"
                     /protein_id="CAA58415.1"
                     /translation="MMDSSPEKTNLELLYERVCEQGREFEVVFYPMLPRLYEMMLPSL
                     EARLNFLSVGYRHVAFARYVHGDVDCVHREVMAQKMVLLTSILSKLLNVNGILEHQEY
                     LNTE"
     gene            54301..55755
                     /gene="U36"
     CDS             54301..55755
                     /codon_start=1
                     /gene="U36"
                     /product="U36"
                     /function="DNA encapsidation; possibly capsid transport;
                     virion protein?"
                     /note="XIRF1; similar to HHV-5 UL52, HVS GENE 68, EBV
                     BFLF1, EHV1 28, VZV 26, HSV1 UL32"
                     /db_xref="GOA:P52463"
                     /db_xref="InterPro:IPR002597"
                     /db_xref="UniProtKB/Swiss-Prot:P52463"
                     /protein_id="CAA58416.1"
                     /translation="MYKGWDSEALPIQSEILNEILLYCYLTPQPPIPSETTTATSPTN
                     IENEISNLDNSENLEELKQLSVALNIDRRCNICSIVNLCLKQNKSWIYDYSLLCYKCN
                     YAPKTPLSLLIVSTEFLMLIRERFPNINFDGLFLNNIVSIFDFHVHFFIHRCFANTVN
                     DHIQSENITLNHMAIIRSTLLKEDTIPHIKIKKFLTKKMNPKKTQSSELNKKLTVPMK
                     TRFTTLLFYMWSGTNVFDRVPFTDLTIRKHRFIKNLYSNKTDIELTAGPILLAQIPFS
                     ITKNKTTSVCLLCELMAASKQDYLFLKYLHQSIMDYCQNNLKMIDRVQFVIADIFEKT
                     KIHTHVKNLSDYSKAIFDNEFSFSDDNFTLDTHVYLILRQTGTVGVYKHFFCDPLCLA
                     NCKTINPEVLFNTTDAGEIQDLKVTICYRNEYLSIVEKHVWLAIHLFKAFQIIKPNHK
                     NKTQITEFLKDFTNLLALHHFDIVDPIFTVNYYV"
     gene            55759..56553
                     /gene="U37"
     CDS             55759..56553
                     /codon_start=1
                     /gene="U37"
                     /product="U37"
                     /function="nuclear phosphoprotein?; nuclear egress"
                     /note="interacts with nuclear egress membrane protein;
                     XIRF2; similar to HHV-5 UL53, HVS GENE 69, EBV BFLF2, EHV1
                     29, VZV 27, HSV1 UL31"
                     /db_xref="GOA:P28865"
                     /db_xref="InterPro:IPR021152"
                     /db_xref="UniProtKB/Swiss-Prot:P28865"
                     /protein_id="CAA58417.1"
                     /translation="MTVHKSRIRRSRSLSVTHRIQKRPDHREKTKLYLQLKLHDLHTV
                     FNLFPEYEQKFLAIIKLPITGKEPIDVPFSLSNHHQHTCLEFSPYANEQISKSACLHC
                     ESVSVPTSSDAMVAHLNQVNNVMQNRLYFYGFRKDMELIRMSAKQPTIFQIFYIVHNT
                     INNIFPIMFERKQKLGMHIVFQSRTLHIPCECIKQIVAVSSGYNVYLDILQESVILTV
                     LCETLDTNTNIHIDIGMLQKKLEEMDIPNEISDRLEKYKGHLIGFH"
     gene            complement(56599..59637)
                     /gene="U38"
     CDS             complement(56599..59637)
                     /codon_start=1
                     /gene="U38"
                     /product="DNA polymerase catalytic subunit"
                     /function="replication, DNA polymerase"
                     /note="XILF0, Pol; similar to polymerase delta ; similar
                     to HHV-5 UL54, HVS GENE 9, EBV BALF5, EHV1 30, VZV 28,
                     HSV1 UL30"
                     /db_xref="GOA:P28857"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR036397"
                     /db_xref="InterPro:IPR042087"
                     /db_xref="UniProtKB/Swiss-Prot:P28857"
                     /protein_id="CAA58372.1"
                     /translation="MDSVSFFNPYLEANRLKKKSRSSYIRILPRGIMHDGAAGLIKDV
                     CDSEPRMFYRDRQYLLSKEMTWPSLDIARSKDYDHMRMKFHIYDAVETLMFTDSIENL
                     PFQYRHFVIPSGTVIRMFGRTEDGEKICVNVFGQEQYFYCECVDGRSLKATINNLMLT
                     GEVKMSCSFVIEPADKLSLYGYNANTVVNLFKVSFGNFYVSQRIGKILQNEGFVVYEI
                     DVDVLTRFFVDNGFLSFGWYNVKKYIPQDMGKGSNLEVEINCHVSDLVSLEDVNWPLY
                     GCWSFDIECLGQNGNFPDAENLGDIVIQISVISFDTEGDRDERHLFTLGTCEKIDGVH
                     IYEFASEFELLLGFFIFLRIESPEFITGYNINNFDLKYLCIRMDKIYHYDIGCFSKLK
                     NGKIGISVPHEQYRKGFLQAQTKVFTSGVLYLDMYPVYSSKITAQNYKLDTIAKICLQ
                     QEKEQLSYKEIPKKFISGPSGRAVVGKYCLQDSVLVVRLFKQINYHFEVAEVARLAHV
                     TARCVVFEGQQKKIFPCILTEAKRRNMILPSMVSSHNRQGIGYKGATVLEPKTGYYAV
                     PTVVFDFQSLYPSIMMAHNLCYSTLVLDERQIAGLSESDILTVKLGDETHRFVKPCIR
                     ESVLGSLLKDWLAKRREVKAEMQNCSDPMMKLLLDKKQLALKTTCNSVYGVTGAAHGL
                     LPCVAIAASVTCLGREMLCSTVDYVNSKMQSEQFFCEEFGLTSSDFTGDLEVEVIYGD
                     TDSIFMSVRNMVNQSLRRIAPMIAKHITDRLFKSPIKLEFEKILCPLILICKKRYIGR
                     QDDSLLIFKGVDLVRKTSCDFVKGVVKDIVDLLFFDEEVQTAAVEFSHMTQTQLREQG
                     VPVGIHKILRRLCEAREELFQNRADVRHLMLSSVLSKEMAAYKQPNLAHLSVIRRLAQ
                     RKEEIPNVGDRIMYVLIAPSIGNKQTHNYELAEDPNYVIEHKIPIHAEKYFDQIIKAV
                     TNAISPIFPKTDIKKEKLLLYLLPMKVYLDETFSAIAEVM"
     gene            complement(59637..62129)
                     /gene="U39"
     CDS             complement(59637..62129)
                     /codon_start=1
                     /gene="U39"
                     /product="glycoprotein B"
                     /function="glycoprotein B, gB, infection"
                     /note="gpB; cleaved glycoprotein linked di-sulfide bonds;
                     similar to HHV-5 UL55, HVS GENE 8, EBV BALF4, EHV1 33, VZV
                     31, HSV1 UL27"
                     /db_xref="GOA:P28864"
                     /db_xref="InterPro:IPR000234"
                     /db_xref="InterPro:IPR035377"
                     /db_xref="InterPro:IPR035381"
                     /db_xref="InterPro:IPR038631"
                     /db_xref="UniProtKB/Swiss-Prot:P28864"
                     /protein_id="CAA58373.1"
                     /translation="MSKMAVLFLAVFLMNSVLMIYCDPDHYIRAGYNHKYPFRICSIA
                     KGTDLMRFDRDISCSPYKSNAKMSEGFFIIYKTNIETYTFPVRTYKKELTFQSSYRDV
                     GVVYFLDRTVMGLAMPVYEANLVNSHAQCYSAVAMKRPDGTVFSAFHEDNNKNNTLNL
                     FPLNFKSITNKRFITTKEPYFARGPLWLYSTSTSLNCIVTEATAKAKYPFSYFALTTG
                     EIVEGSPFFNGSNGKHFAEPLEKLTILENYTMIEDLMNGMNGATTLVRKIAFLEKADT
                     LFSWEIKEENESVCMLKHWTTVTHGLRAETNETYHFISKELTAAFVAPKESLNLTDPK
                     QTCIKNEFEKIINEVYMSDYNDTYSMNGSYQIFKTTGDLILIWQPLVQKSLMFLEQGS
                     EKIRRRRDVGDVKSRHDILYVQLQYLYDTLKDYINDALGNLAESWCLDQKRTITMLHE
                     LSKISPSSIVSEVYGRPISAQLHGDVLAISKCIEVNQSSVQLHKSMRVVDAKGVRSET
                     MCYNRPLVTFSFVNSTPEVVPGQLGLDNEILLGDHRTEECEIPSTKIFLSGNHAHVYT
                     DYTHTNSTPIEDIEVLDAFIRLKIDPLENADFKVLDLYSPDELSRANVFDLENILREY
                     NSYKSALYTIEAKIATNTPSYVNGINSFLQGLGAIGTGLGSVISVTAGALGDIVGGVV
                     SFLKNPFGGGLMLILAIVVVVIIIVVFVRQRHVLSKPIDMMFPYATNPVTTVSSVTGT
                     TVVKTPSVKDVDGGTSVAVSEKEEGMADVSGQVSDDEYSQEDALKMLKAIKSLDESYR
                     RKPSSSESHASKPSLIDRIRYRGYKSVNVEEA"
     gene            complement(62083..64263)
                     /gene="U40"
     CDS             complement(62083..64263)
                     /codon_start=1
                     /gene="U40"
                     /product="U40"
                     /function="transport protein?"
                     /note="transport/capsid assembly protein; similar to HHV-5
                     UL56, HVS GENE 7, EBV BALF3, EHV1 32, VZV 30, HSV1 UL28"
                     /db_xref="GOA:P52384"
                     /db_xref="InterPro:IPR000501"
                     /db_xref="UniProtKB/Swiss-Prot:P52384"
                     /protein_id="CAA58374.2"
                     /translation="MNSLQSLCVLCARLNECALDLECLKFCDPVIVLSDMANFKKNGI
                     VILHLYQTFFEGIKEQNLLCASALTVYMQVLLKAMYEQVLLLDAALESFMVDQDRKKY
                     FEKVLCLRRCAEHLSINISLNNGVEFIVQLSTLNDIEQLISKINSVYALLLPQEGLQI
                     CGKIIDLLTIMCGACMVAKPESYLETKTCMKCYEELTLTPNQGKSLRRRLHGKFCNHL
                     TEQKAFFNIEKNIETIEKDLGEAILNYGTVQSVATEIKKIFKQQRSAESLHVSDAEKT
                     LKKYNIFSKVPDVIYSLSEFTYWSKISETIVRNVAITLQQLNSCHTLYKQLQNDVSLY
                     LYGEVSEDFLALSENLLTHDERLYVGSIYVSPSRLIDLVTGLSIKNLEESPIFKRLAE
                     EDEVQHKIKSLLHDIRDPQTTETPGRLNTINCMLQTHNLQQEVLARKKAYFQKVSESG
                     YNRVMACIREQESLINKVVSVNVYGNFIFEALSKIMNGFVLRKMYLDGSFRVDSCTYD
                     EHLYIKNNLMPKKLPLELLPDLSEIMYTLLTGPLSDFHKSAYPLPANISMAYGCDHAE
                     MLPHMKEDLARCIEGTIHPSVWMVCEYNEFFNFSGVTDVNDMQKKMWNFIRELTLSVA
                     LYNDVFGKRLKIVRIDEEGDLSGNVVLTFNHESPLLFHTGGGMTKFKDVYSLLYCDLQ
                     AQLSRETVDVPEGVSYSVRTPNLLDLVRENEQDGSIIPGCLFDE"
     gene            complement(64271..67669)
                     /gene="U41"
     CDS             complement(64271..67669)
                     /codon_start=1
                     /gene="U41"
                     /product="major DNA binding protein"
                     /function="replication, single-stranded DNA binding
                     protein"
                     /note="mdbp; similar to HHV-5 UL57, HVS GENE 6, EBV BALF2,
                     EHV1 31, VZV 29, HSV1 UL29"
                     /db_xref="GOA:P52338"
                     /db_xref="InterPro:IPR000635"
                     /db_xref="InterPro:IPR035989"
                     /db_xref="UniProtKB/Swiss-Prot:P52338"
                     /protein_id="CAA58375.1"
                     /translation="MADENETVVSAPVSTAAWIYVFPKDKELLDVLSVLSLMERNSPI
                     VISPLLMNLTVENDFSTTVKTPITNFGGTILTKITSFMPVCFFFHGTEQLVGMAEDHG
                     DLIRLCEQTRQKFHLQSFEVPTARKVIDIKALCSAVGKDADSVICHVACGNGFKELLF
                     AGLLIPCVEEQIQVQVGEYSCVKIPLYSATLFETEETISLSSCTEFIQERGFFLPALS
                     ETLFYYVFTSWGTTLRFSNTKELIDAGLKQFTQDGEQTVKLAPHKTYLGISGQKISAV
                     EKDFLMLVDSVVTELSFSHVAEYLDSVYDPSQIMNFNDWPIIRNSETHAERMAQLTNL
                     KLHLSSHLAVLIFAPNSILYCSKLAFIPNVKQAFNSVMTQELLLRSLSFCNALSSLSD
                     DVYNDNRKIIKCDSTSGKDDKFSANHLAYACATSPQLLSFVVWNLNRMSVYNAGNAHT
                     EIYNHLVNCSANLCEFCDGKCCQSCIGTAMVRVGTRLPAIPKNVKKEPLVMSMFSRYY
                     AEVDILGSFGRKPVSELKEIGKDQQNTLSLDRGKFVSQIFDYCKKNSLIDPVTGEDTF
                     NVRSKKDFVSIIHGLTQCIEECVSRCIVEMRRTQTPREQIENCLQSFNVDTTPYATAF
                     SPFLTFSYYKVILTVLQNLALIVASGHVVDRPCTGNSISKWLVQQYQSLYGTFHSSYL
                     KKGFLNTRTVKVASNVDMEQILDCDLYKSGKYVKTTIQAKLCRLSMQCLRDFRIKNRP
                     FNKSSKTAHNNPYFKKNVKHKKNPLSGCISFLLFKYHDKLFPNVKISCLELWQRFLLN
                     NVPKTLDIGNPEEVKTFIKFAFSITNTYDEIDIIDIQPECLSTFIDCYFHNKFLSALG
                     FHDYLTSLHGLTSKLVTQNPVLFPVVLDKQPKFSSIQEYLVYVKKLVLDGVPNPVIAS
                     LSKEPNFGTIFTSRSLVTFGLTLEKFVSLANREYFQFGQLGWIGGSGVDRNLNPTSSA
                     LQDFRFMRQKTIIATKFSEVIVKKVRREAIMFDTEVVKGKVLSIVENLTNDIDPELLI
                     IAEVMRDREDKPTMDDMLFFVDGREALAASIMLKLNHLVDMNVKDFSITNLQSVFETV
                     SSNDAPVYDFSEILAEEDDQGNGVLKCDETETETDEPMTKKNRL"
     rep_origin      67666..68042
                     /note="ori-lyt; minimal origin of replication as in
                     Dewhurst 1993 citation; included efficient ori-Lyt mori as
                     in Turner 2002 citation; origin of bi-directional DNA
                     replication during lytic cycle"
                     /citation=[1]
                     /citation=[2]
     gene            complement(69103..70650)
                     /gene="U42"
     CDS             complement(69103..70650)
                     /codon_start=1
                     /gene="U42"
                     /product="transactivator"
                     /function="transactivation?; post-transcriptional
                     processing?; similar to RNA metabolism and transport RNA
                     binding protein"
                     /note="similar to HHV-5 UL69, HVS GENE 57, EBV BMLF1, EHV1
                     5, VZV 4, HSV1 UL54"
                     /db_xref="GOA:P52354"
                     /db_xref="InterPro:IPR008648"
                     /db_xref="UniProtKB/Swiss-Prot:P52354"
                     /protein_id="CAA58376.2"
                     /translation="MYPRGVKRSHHDYHRQTAFRTIKRSTHRQTSKFISHFAKNFRGK
                     LAPLKQLDESRLDALSLTELEQLKTIIEEKQQEKRAQNNAITFLPNLPTVPFADTNFS
                     LKSLGLRPYNGDARDPKQRIRDRFPQTHERICLLTNDILETDLLLRYRQCLDSLTREE
                     NQQLMGDRIFSLTNSPCLAFTVATVEEACSYFKFHDLHNLPVNPQDLFMYTITVMKFE
                     FFNKLNMAKLTCVFNDNGHGDIEYRKLRQLCGKPVLDREMPNSELEVQQQTPDSFRHP
                     IQQAMSIVVTFARILRQIKEQIIQTKKPQFIRDFDTGRVAERYECGLMSRLIGKQFSN
                     HKCDDVSCQNRIERIMAPWKPSLFFCTYFAKDAPKFKLFPNFPEEYRNLSFTCPKVDT
                     EPSCSYSTNHDLPQTSHRSHKNHGTPKVKSKVCVEKPDTSILTTTKTTTEILIEESME
                     TDNKIPNPRELNFNQAKQEEIVIININENVNSKHESESSVEMDLDLDYEADTCETNLN
                     ACSSDSE"
     gene            complement(70875..73457)
                     /gene="U43"
     CDS             complement(70875..73457)
                     /codon_start=1
                     /gene="U43"
                     /product="helicase/primase complex protein"
                     /function="replication; helicase/primase complex,
                     primase?"
                     /note="helicase /primase complex similar to HHV-5 UL70,
                     HVS GEEN 56, EBV BSLF1, EHV1 7, VZV 6, HSV1 UL52"
                     /db_xref="GOA:P52467"
                     /db_xref="InterPro:IPR033685"
                     /db_xref="UniProtKB/Swiss-Prot:P52467"
                     /protein_id="CAA58377.1"
                     /translation="MTIVVFATEYDAANVIFSILCRSPSEHLIFPIIVKYKPSNNVSF
                     CLQTQKCKNSKRIDTVFVCHAEKLNLSHYIQTASPIKAEDVANSLNDKETESLYVDMI
                     LSQTGKEREDVEFKYMAYFHKSLIIKYLTGKFLLPTSPFWFLSTYGQTEGMLLLTMFY
                     YLFEEQKSTITTTKNYVQCFTENTGNMVFTYSSMSEFINITLKSKFRKLFADFSTYAR
                     QKNLRDKEEFKHLDTQINLFRKSSHLTNTFRVHYIYIAYNTALETTKFVNYCNLTSYD
                     SNLPIGQQCQRNLHILGNSLHENLLCIMKQYFNADCYFKTYIDIKRLKNPNLNVTEYE
                     YALVSKKKTIQALTSEQITRAIAKCNKNGEGLFSPVKPGLQGLLEISASDRYVQIQDK
                     RIYRRQHLHKDYHRPFPVFRVQLLHKNIFCFGNSEDWYENMGFNRILQYLPDEYISDE
                     ALTRAIWLQDTHFLCDDVEKQFYTTRHEIFNERIPVTNYIGDLDLPLQDTATITEETF
                     FSMCRLIRLTLINAWKKIFPSIDTDTHPIFFFKTQCDTTNDTLDYTEDPTEIKQFCVC
                     RKKIGLRISIPLPNGTAIAGGEPLKQLSKILNHVMCLDQELSQILNSITFPGECFDIG
                     IYHTGHCIRIGYMYKTDMDKGKMLHGRLTPIFIVPEGYRNSCKTFIQMQMDLNNLLHH
                     GTKKAPIEELIYNITDKGCPKENLSFMDLKSRQLWNKVNIATETLITKYLNTHGFNNN
                     ATSADDSLLSFIRLIGWPIIKTQLITHYETRIAQQFSQVTFIKIDSKNLQIKKTQFGR
                     VSDFSCLNRQHRGNRDNVLVYIQLKADGNRLILILWSTCFATKCQSNSKQVHCSIALE
                     QLKN"
     gene            73522..74139
                     /gene="U44"
     CDS             73522..74139
                     /codon_start=1
                     /gene="U44"
                     /product="U44"
                     /note="similar to HHV-5 UL71, HVS GENE 55, EBV BSRF1, EHV1
                     8, VZV 7, HSV1 UL51 (?)"
                     /db_xref="GOA:P52473"
                     /db_xref="InterPro:IPR007619"
                     /db_xref="UniProtKB/Swiss-Prot:P52473"
                     /protein_id="CAA58378.2"
                     /translation="MGNCFRRLSLFGQPTQAKYEMLCSSDDLETEELTFFLDMTYKDF
                     GVYQNDIISHQKDTETMKTLLGLLPMYKKTKLRHTVMERCLSNCPNHVKDALCVELMK
                     AEKILQTMDVVFMKTLIGEFSMCTENLNQLLNKFATDQSTLSDVEKINSLIEIDGENS
                     KRLLVELDPILHEETGLYQALPNVVTEAPSEKVKSIRVESEGESV"
     gene            complement(74140..75270)
                     /gene="U45"
     CDS             complement(74140..75270)
                     /codon_start=1
                     /gene="U45"
                     /product="U45"
                     /function="putative dUTPase"
                     /note="BHLF3; similar to HHV-5 UL72, HVS GENE 54, EBV
                     BLLF2, EHV1 9, VZV 8, HSV1 UL50"
                     /db_xref="GOA:Q06095"
                     /db_xref="InterPro:IPR029054"
                     /db_xref="InterPro:IPR034745"
                     /db_xref="InterPro:IPR036157"
                     /db_xref="UniProtKB/Swiss-Prot:Q06095"
                     /protein_id="CAA58379.1"
                     /translation="MYSAISEKISETITLQRQTSSRYIEFFVFRNVDINELWTTDISE
                     DKTHDVWPAVNEKSFKKFLENELTSYQRPIPLLGIPQNGTVSKTCKKEKQRETDCVNY
                     ERKRGNPVTFYPRHRAKRNANTDTCISEEPSILVSHHRNSKMDVFMDTNKITLVNREL
                     IWVPHDQVRIVKLDISLYIPDGFFGVITGHSNDVFCECVTEIITDETDISVFLMNLSE
                     HSLMLLPGDVEFSINFLPCYIPEPWEMINLSPPEFAIFHLKASREFIAKPNSYTIQYF
                     DAMYVCADELKALMIPSKEIAKLGLLIETYIWNKDTIPSIKIFNSTRKTIYIPTGICI
                     ARIIFTCGHFCLSLMPERAINRLQVLDANSSFLFHYAASNNA"
     gene            75343..75597
                     /gene="U46"
     CDS             75343..75597
                     /codon_start=1
                     /gene="U46"
                     /product="membrane/secreted protein"
                     /function="membrane/secreted protein, virion
                     morphogenesis"
                     /note="glycoprotein N; gN; BHRF1; similar to HHV-5 UL73,
                     HVS GENE 53, EBV BLRF1, EHV1 10, VZV 9A, HSV1 49A"
                     /db_xref="GOA:Q06094"
                     /db_xref="InterPro:IPR005211"
                     /db_xref="InterPro:IPR034707"
                     /db_xref="UniProtKB/Swiss-Prot:Q06094"
                     /protein_id="CAA58380.1"
                     /translation="MSCKKSARQSLYVSLCLFYILVFAAATEVDFYSPECHSHTYEIV
                     LNSFSSIWLLINLFLLLCSFAIFLKYWCYKTFASETVKGY"
     gene            complement(75964..77919)
                     /gene="U47"
     CDS             complement(75964..77919)
                     /codon_start=1
                     /gene="U47"
                     /product="glycoprotein O"
                     /function="membrane/secreted glycoprotein, associated with
                     gH/gL; virion morphogenesis"
                     /note="gO; BHLF2, variable glycoprotein; positional
                     similar to HHV-5 UL74, HVS GENE 51(?)"
                     /db_xref="GOA:Q06093"
                     /db_xref="InterPro:IPR008645"
                     /db_xref="UniProtKB/Swiss-Prot:Q06093"
                     /protein_id="CAA58381.1"
                     /translation="MHLEVIVQSYKKSKYYFSHTFYLYKFIVVNSPDMLHISRLGLFL
                     GLFAIVMHSVNLIKYTSDPLEAFKTVNRHNWSDEQREHFYDLRNLYTSFCQTNLSLDC
                     FTQILTNVFSWDIRDSQCKSAVSLSPLQNLPRTEIKIVLSSTTANKSIIASSFSLFYL
                     LFATLSTYTADPPCVELLPFKILGAQLFDIKLTEESLRMAMSKFSNSNLTRSLTSFTS
                     KNFFNYTSFVYFLLYNTTSCVPSNDQYFKQSPKPINVTTSFGRAIVNFDSILTTTPSS
                     TSASLTSPHIPSTNIPTPAPPPVTKNSTKLHTDTIKVTPNTPTITTQTTESIKKIVKR
                     SDFPRPMYTPTDIPTLTIRLNATIKTEQNTENPKSPPKPTNFENTTIRIPKTLESATA
                     TTNATQKIESTTFTTIGIKEINGNTYSSPKNSIYLKSKSQQSTTKFTDAEHTTPILKF
                     TTWQNTVRTYMSHNTEVQNMTDKFQRTTLKSSNELPTIQTLSVTPKQKLPSNVTAKTE
                     VHITNNALPSSNSSYSITEVTKEVKHTRMSASTHEQINHTEIAQITPILNAHTSEKST
                     TPQRSFTAETFLTTSSKPNIITWSNLLTTTPKEPLTNTSLRWTDHITTQLTTSNRTQS
                     AKLTKANISSQTTNIYPQTITGRSTEV"
     gene            77903..78067
                     /gene="U47A"
     CDS             77903..78067
                     /codon_start=1
                     /gene="U47A"
                     /product="glycoprotein"
                     /function="membrane/secreted glycoprotein; conmtains a
                     potential transmembrane domain"
                     /db_xref="GOA:A0A2N9DYZ4"
                     /db_xref="UniProtKB/TrEMBL:A0A2N9DYZ4"
                     /protein_id="SPC53497.1"
                     /translation="MTSKCMLCWTAITNALAILMLLLVIYRAIIGFNGDIYTSTLSAF
                     SCIRTNSSNT"
     gene            complement(78086..80170)
                     /gene="U48"
     CDS             complement(78086..80170)
                     /codon_start=1
                     /gene="U48"
                     /product="glycoprotein H"
                     /function="infection, cell fusion, immunogen; associates
                     with gL and either gO or gQ"
                     /note="gH; BHLF1; gH and gL (U82) form a complex (gH/gL);
                     induces neutralising and syncytia inhibiting antibodies ;
                     similar to HHV-5 UL75, HVS GENE 22, EBV BXLF2, EHV1 39,
                     VZV37, HSV1 UL22"
                     /db_xref="GOA:P68324"
                     /db_xref="InterPro:IPR003493"
                     /db_xref="InterPro:IPR035305"
                     /db_xref="InterPro:IPR038172"
                     /db_xref="UniProtKB/Swiss-Prot:P68324"
                     /protein_id="CAA58382.1"
                     /translation="MLLRLWVFVLLTPCYGWRPLNISNSSHCRNGNFENPIVRPGFIT
                     FNFYTKNDTRIYQVPKCLLGSDITYHLFDAINTTESLTNYEKRVTRFYEPPMNDILRL
                     SPVPSVKQFNLDRSIQPQVVYSLNMYPSQGIYYVRVVEVRQMQYDNVSCKLPNSLKEL
                     IFPVQVRCAKITRYVGEDIYTHFFTPDFMILYIQNPAGDLTMMYGNTTSINFKAPYKK
                     SSFIFKQTLTDDLLLIVEKDVIDVQYRFISDATFVDETLNDVDEVEALLLKFNNLGIQ
                     TLLRGDCKKPNYAGIPQMMFLYGIVHFSYSTKNTGPMPVLRVLKTHENLLSIDSFVNR
                     CVNVSEGTLQYPKMKEFLKYEPSDYSYITKNKSISVSTLLTYLATAYESNVTISKYKW
                     TDIANTLQNIYEKHMFFTNLTFSDRETLFMLAEIANIIPTDERMQRHMQLLIGNLCNP
                     VEIVSWARMLTADRAPNLENIYSPCASPVRRDVTNSFLKTVLTYASLDRYRSDMMEML
                     SVYRPPNMERVAAIQCLSPSEPAASLTLPNVTFVISPSYVIKGVSLTITTTIVATSII
                     ITAIPLNSTCVSTNYKYAGQDLLVLRNISSQTCEFCQSVVMEYDDIDGPLQYIYIKNI
                     DELKTLTDPNNNLLVPNTRTHYLLLAKNGSVFEMSEVGIDIDQVSIILVIIYILIAII
                     ALFGLYRLIRLC"
     gene            80329..81087
                     /gene="U49"
     CDS             80329..81087
                     /codon_start=1
                     /gene="U49"
                     /product="U49"
                     /function="putative fusion protein"
                     /note="BHRF2; similar to HHV-5 UL76, HVS GENE 20, EBV
                     BXRF1, EHV1 37, VZV 35, HSV1 UL24"
                     /db_xref="GOA:Q06092"
                     /db_xref="InterPro:IPR002580"
                     /db_xref="UniProtKB/Swiss-Prot:Q06092"
                     /protein_id="CAA58383.1"
                     /translation="MSLTGLPDIRKKIGQFHHLRIYKQILSLQGNFARLNYFLGDVFP
                     ANLRSASVSVFFEVRLGPRIPDCIVLLKSVDAKDEFAFHCYFFEFKTTLGKSTMQSVH
                     HNCIHQAQYLQGLRQLQQSISFLDQYLIADEVSWNVVPVICFFRQWGLKLDFFKKFSG
                     KTKRLSFSFIRDLFARSQDGAVQSLLSIPNYTNFRRACQKHTDLYRKRCRKAPKSVLT
                     KTSGENRSRASRQVAKNAPKNRIRRTAKKDAKRQ"
     gene            80864..82531
                     /gene="U50"
     CDS             80864..82531
                     /codon_start=1
                     /gene="U50"
                     /product="U50"
                     /function="virion protein"
                     /note="BHRF3; similar to HHV-5 UL77, HVS GENE 19, EBV
                     BVRF1, EHV 36, VZV 34, HSV1 UL25"
                     /db_xref="GOA:P52387"
                     /db_xref="InterPro:IPR002493"
                     /db_xref="UniProtKB/Swiss-Prot:P52387"
                     /protein_id="CAA58384.1"
                     /translation="MAQCNLFYQYPITPILEGHVRNILICTEKDVEKLQSQSSLRLRE
                     KIDQGHRDKLLRMRLKTELDALQKKMQKDSDVLNSHLKAIEDALLFTNDGEVNVETKA
                     DAQLIPKSPEKLEKFNQVAITPLDPFIRFTDDFRGEMINTFFNNAQMWNFTFGSWFYK
                     LKRVFYNEPGLRRALKLTNVDSLTISKELLAVTVNALEQATVYPIFGSEMSDLEAALC
                     ILAAFYSTYENSQIDERTTLVDVITLLPVIFRLLGSEITALKNVSPSGTYFGFNDPSC
                     MKFFVPMRKGKHYAENTFGNHVLIKMLLGRGVMQKIPGEKISQNFDVEARLHGAIKND
                     VLVYWTYQLMRPKLGNNVPIFIHDQHYLRSGLVAIESLFLLWRILNSESLFNKRVGKF
                     LLTSIFPQLENVDFAENNFEAGNIQNFEYLMHHYVVPMYNLQNDISISTLFPGLVAVC
                     VNESVRLGWEHKCAGAPSDAVQVQSKENPFVEYIRAQMEQQADVAILEKHDCILFHLE
                     NGLNITLSFTLPRQRLFAMASSLFNVNDTYDFIYFLVLGFLPIPAVI"
     gene            82626..83531
                     /gene="U51"
     CDS             82626..83531
                     /codon_start=1
                     /gene="U51"
                     /product="GCR"
                     /function="G-protein coupled receptor; CC chemokine
                     receptor; constitutive and inducuble signalling"
                     /note="XKRF1; similar to HHV-5 UL78, HVS GCR GENE 74;
                     similar to all G-protein coupled receptors"
                     /db_xref="GOA:P52382"
                     /db_xref="InterPro:IPR000276"
                     /db_xref="InterPro:IPR017452"
                     /db_xref="UniProtKB/Swiss-Prot:P52382"
                     /protein_id="CAA58385.1"
                     /translation="MEKETKSLAWPATAEFYGWVFIFSSIQLCTMVLLTVRFNSFKVG
                     REYAVFTFAGMSFNCFLLPIKMGLLSGHWSLPRDFCAILLYIDDFSIYFSSWSLVFMA
                     IERINHFCYSTPLLNENSKALAKVCFPIVWIISGVQALQMLNNYKATALQNETPQCFL
                     AFLRSGYDMWLMLVYSVMIPVMLVFIYIYSKNFMLLKDELSTVTTYLCIYLLLGTIAH
                     LPKAGLSEIESDKIFYGLRDIFMALPVLKVYYIPVMAYCMACDDHTVPVRLCSIWLVN
                     LCKKCFSCTRREKESDLEVGIKMLK"
     gene            complement(83550..84326)
                     /gene="U52"
     CDS             complement(83550..84326)
                     /codon_start=1
                     /gene="U52"
                     /product="U52"
                     /note="XKLF1; similar to HHV-5 UL79, HVS GENE 18, EBV
                     BVRF1.5a/b"
                     /db_xref="InterPro:IPR004290"
                     /db_xref="UniProtKB/Swiss-Prot:P52469"
                     /protein_id="CAA58386.1"
                     /translation="MTQIGQYIKLNDAVPNLILHITTKLLRNENLTSFKQEELLLIQH
                     VCTSMLSHGIKILLLRESLYNSGIGDIVILNRKISNNYWFRIFSILKQHSDAELLRHM
                     FNESHSAYISKKLHYSGNVSHMINFLFMDEFGVNLKIPEELICEGNIVFSVGAIYNHR
                     LLKICRFFNRFWGDQEREPTVRLICKHLWFAYLIMFGKFEISTLAYSQQRAEHKAGLF
                     SFLQNDFKVFCGMSENPQLLDSSAIFDLTGISAEDLFSYE"
     gene            84333..85919
                     /gene="U53"
     CDS             84333..85919
                     /codon_start=1
                     /gene="U53"
                     /product="protease/assembly protein"
                     /function="protease, assembly / scaffolding protein"
                     /note="XKRF1, OR; U53 protease, U53a in-frame assembly
                     protein, AP; similar to HHV-5 UL80, HVS GENE 17, EBV
                     BVRF2, EHV1 35, VZV 33, HSV1 UL26"
                     /db_xref="GOA:P24433"
                     /db_xref="InterPro:IPR001847"
                     /db_xref="InterPro:IPR035443"
                     /db_xref="UniProtKB/Swiss-Prot:P24433"
                     /protein_id="CAA58387.1"
                     /translation="MSKVWVGGFLCVYGEEPSEECLALPRDTVQKELGSGNIPLPLNI
                     NHNEKATIGMVRGLFDLEHGLFCVAQIQSQTFMDIIRNIAGKSKLITAGSVIEPLPPD
                     PEIECLSSSFPGLSLSSKVLQDENLDGKPFFHHVSVCGVGRRPGTIAIFGREISWILD
                     RFSCISESEKRQVLEGVNVYSQGFDENLFSADLYDLLADSLDTSYIRKRFPKLQLDKQ
                     LCGLSKCTYIKASEPPVEIIVAATKVAGDQVQLTTEPGSELAVETCDVPVVHGNYDAV
                     ESATATTAMSNQNLPNTTPLLSSPPFSDCVFLPKDAFFSLLNVTTGQQPKIVPPVSVH
                     PPVTEQYQMLPYSESAAKIAEHESNRYHSPCQAMYPYWQYSPVPQYPAALHGYRQSKT
                     LKKRHFQSDSEDELSFPGDPEYTKKRRRHRVDNDDDKEMAREKNDLRELVDMIGMLRQ
                     EISALKHVRAQSPQRHIVPMETLPTIEEKGAASPKPSILNASLAPETVNRSLAGQNES
                     TDLLKLNKKLFVDALNKMDS"
     gene            85185..85919
                     /gene="U53.5"
     CDS             85185..85919
                     /codon_start=1
                     /gene="U53.5"
                     /product="capsid scaffold protein"
                     /function="protease, assembly/scaffolding protein"
                     /db_xref="UniProtKB/TrEMBL:A0A2N9DYY9"
                     /protein_id="SPC53499.1"
                     /translation="MSNQNLPNTTPLLSSPPFSDCVFLPKDAFFSLLNVTTGQQPKIV
                     PPVSVHPPVTEQYQMLPYSESAAKIAEHESNRYHSPCQAMYPYWQYSPVPQYPAALHG
                     YRQSKTLKKRHFQSDSEDELSFPGDPEYTKKRRRHRVDNDDDKEMAREKNDLRELVDM
                     IGMLRQEISALKHVRAQSPQRHIVPMETLPTIEEKGAASPKPSILNASLAPETVNRSL
                     AGQNESTDLLKLNKKLFVDALNKMDS"
     gene            complement(86103..87479)
                     /gene="U54"
     CDS             complement(86103..87479)
                     /codon_start=1
                     /gene="U54"
                     /product="U54"
                     /function="tegument phosphoprotein, transactivation?"
                     /note="1L, similar to HHV-5 UL82/83, pp65 /72K, possible
                     virion transactivator IE genes"
                     /db_xref="GOA:P24434"
                     /db_xref="InterPro:IPR008649"
                     /db_xref="UniProtKB/Swiss-Prot:P24434"
                     /protein_id="CAA58388.1"
                     /translation="MQPATLQWSSYVLQLRVTTTAILKPGELRLFKCGLGITPPSSAV
                     VCICRDESSFTSSPFTYIDPKDYGNIPFAVQNISDLDLDLSRLPIVLNIFALPHANVN
                     ISNLPVQRIEAHDRHIIPHGQCDAKFVIYGPLTRIKIQVADIRWIEQTPEEPTRYSFK
                     AEIWVNLQNTPLDQIFKTGNIEFISHKNVYISRILLCGNLLILKANYENDYLLDDNFY
                     PEQLAIQISLTPQTADITLSQNQETLLKCNTHSITVCATKNIIPNTVTPVHCSFNTIF
                     NSNSNFTGLFIPKLLLGISTTTGIWDETRPLYITMKAFKKNRRINYSQPIGVVYFFPK
                     QILPPGNNVEFNWTEASKIYVNTESPNGPVRNTVTFTNQAVLRTPSLSTVANLTPDIN
                     MGIFLSSLRVAFDTAHMVPLHFSLKPGESTRMEFMPPGTPQNLTILEGDVGIHFIPCH
                     NHSHRSSP"
     gene            complement(87557..88855)
                     /gene="U55"
     CDS             complement(87557..88855)
                     /codon_start=1
                     /gene="U55"
                     /product="U55"
                     /note="2L, similar to HHV-5 UL84"
                     /db_xref="InterPro:IPR009479"
                     /db_xref="UniProtKB/Swiss-Prot:P24435"
                     /protein_id="CAA58389.1"
                     /translation="MFSPQLNHVLQLVFDCNHIVSNSYQEIILKCRISSTKPGILFIT
                     DGTESETEDVLFDVQFLEKTTTIKIKILPISRTVPVRIHLFSIPIYLPSHALEIDDIN
                     ALCQKENIDPTVYEQYGLTNMPISTTNVINQFKVVQNDSVEMSLILFNLNWTESPYQS
                     QKLDRYGRKLLIVFSVFSIDTRECPYWENLFKSIIPLCRVNMISEPGISIYKIEFNDP
                     FLTVFLRNVVLPENKRRFPITKECYLRLTFSPPDRSTVTLNMNMPYFKICADGKNLEV
                     FFPNDMSLVSNTNKEITLRGEFTNKKIVGIFIPVQTHVFKLYPFLWFAQEPLKLRISC
                     ERTVSVTEHDMLGRVFFVTKKLFRKPFRSLSNSDMKSLLTHTENTDKPFDVHFMGNCF
                     PAYLLPELTLHPLEYEDKPARGNPQTLPSVEKHSIIKIRI"
     gene            complement(89035..89925)
                     /gene="U56"
     CDS             complement(89035..89925)
                     /codon_start=1
                     /gene="U56"
                     /product="U56"
                     /function="probable capsid protein"
                     /note="3L; similar to HHV-5 UL85, HVS GENE 26, EBV BDLF1,
                     EHV1 43, VZV 41, HSV1 UL18"
                     /db_xref="GOA:P24436"
                     /db_xref="InterPro:IPR002690"
                     /db_xref="UniProtKB/Swiss-Prot:P24436"
                     /protein_id="CAA58390.1"
                     /translation="METVYCTFDHKLSLSDISTLCKLMNIVIPIPAHHHLIGSGNLGL
                     YPIVSSNKDYVHVRNVLRTMVVTILQKVEGNQLVLRKPVTGHQYAIKNTGPFPWEKGD
                     TLTLIPPLSTHSEEKLLKLGDWELTVPLVVPTAIAAEINIRLLCIGLIAVHREYNEMQ
                     TIIDELCSIQYRDVLIKLPDIVNDKQSMYSMKTACISLSMITAMAPDIVRTYIDRLTL
                     EDHSMLLIKCQELLSKRTTLNTQRCGQLHATEIKDELKKVKSVLTMIDQINSLTNEKT
                     YFVVCDVSADNRMATCIYKN"
     gene            complement(89927..93964)
                     /gene="U57"
     CDS             complement(89927..93964)
                     /codon_start=1
                     /gene="U57"
                     /product="major capsid protein"
                     /function="major capsid protein"
                     /note="4L, mcp; similar to HHV-5 UL86 (MCP), HVS GENE 25,
                     EBV BcLF1, EHV1 42, VZV 40, HSV1 UL19"
                     /db_xref="GOA:P17887"
                     /db_xref="InterPro:IPR000912"
                     /db_xref="InterPro:IPR023233"
                     /db_xref="UniProtKB/Swiss-Prot:P17887"
                     /protein_id="CAA58391.2"
                     /translation="MENWQATEILPKIEAPLNIFNDIKTYTAEQLFDNLRIYFGDDPS
                     RYNISFEALLGIYCNKIEWINFFTTPIAVAANVIRFNDVSRMTLGKVLFFIQLPRVAT
                     GNDVTASKETTIMVAKHSEKHPINISFDLSAACLEHLENTFKNTVIDQILNINALHTV
                     LRSLKNSADSLERGLIHAFMQTLLRKSPPQFIVLTMNENKVHNKQALSRVQRSNMFQS
                     LKNRLLTSLFFLNRNNNISYIYRILNDMMESVTESILNDTNNYTSKENVPLDGVLLGP
                     IGSIQKLTSILSQYISTQVVSAPISYGHFIMGKENAVTAIAYRAIMADFTQFTVNAGT
                     EQQDTNNKSEIFDKSRAYADLKLNTLKLGDKLVAFDHLHKVYKNTDVNDPLEQSLQLT
                     FFFPLGIYIPSETGFSTMETRVKLNDTMENNLPTSVFFHNKDQVVQRIDFADILPSVC
                     HPIVHDSTIVERLMKSEPLPTGHRFSQLCQLKITRENPARILQTLYNLYESRQEVPKN
                     TNVLKNELNIEDFYKPDNPTLPTERHPFFDLTYIQKNRATEVLCTPRIMIGNIPLPLA
                     PVSFHEARTNQILEHAKTNCQNYDFTLKIVTESLTSGSYPELAYVIETLVHGNKHAFM
                     ILKQVISQCISYWFNMKHILLFCNSFEMIMLISNHMGDELIPGAAFAHYRNLVSLIRL
                     VKRTISISNLNEQLCGEPLVNFANALFDGRLFCPFVHTMPRNDTNAKITADDTPLTQN
                     TVRVRNYEISDVQRMNLIDSSVVFTDNDRPSNETTILSKIFYFCVLPALSNNKACGAG
                     VNVKELVLDLFYTEPFISPDDYFQENPITSDVLMSLIREGMGPGYTVANTSCIAKQLF
                     KSLIYINENTKILEVEVSLDPAQRHGNSVHFQSLQHILYNGLCLISPITTLRRYYQPI
                     PFHRFFSDPGICGTMNADIQVFLNTFPHCQRNDGGFPLPPPLALEFYNWQRTPFSVYS
                     AFCPNSLLSIMTLAAMHSKLSPVAIAIQSKNKIHPGFAATLVRTDNFDVECLLYSSRA
                     ATSIILDDPTVTAEAKDIATTYNFTQHLSFVDMGLGFSSTTATANLKRIKSDMGSKIQ
                     NLFSAFPIHAFTNADINTWIRHHVGIEKPNPSESEALNIITFGGINKNPPSILLHGQQ
                     AICEVILTPVTTNINFFKSPHNPRGRESCMMGTDPHNEEAARKALYDHTQTDSDTFAA
                     TTNPWASLPGSLGDILYNTAHREQLCYNPKTYSPNAQFFTESDILKTNKMMYKVISEY
                     CMKSNSCLNSDSEIQYSCSEGTDSFVSRPCQFLQNALPLHCSSNQALLESRSKTGNTQ
                     ISETHYCNYAIGETIPFQLIIESSI"
     gene            93976..96294
                     /gene="U58"
     CDS             93976..96294
                     /codon_start=1
                     /gene="U58"
                     /product="U58"
                     /note="5R; similar to HHV-5 UL87, HVS GENE 24, EBV BcRF1"
                     /db_xref="InterPro:IPR004285"
                     /db_xref="InterPro:IPR007618"
                     /db_xref="UniProtKB/Swiss-Prot:P24437"
                     /protein_id="CAA58350.2"
                     /translation="MQHTGNCETLIVNSCFGSTCARSIPVFIDSCDLTAEVSRDEETR
                     LARSVPVVLEKIESIIEKIFQTSGPNIVHDKDRAKIALCRLLLGPVAVPCFCEEWDTN
                     DYLSKSGCKCIGPILYIHTSRCRCSDIPVFKFSIMKDYYASHVFRGLLSLKEWNTHLP
                     NVLCTCELSMSDRYVATVYPKQNSIYLEYYPYFLCYLCRHLTVIEIEQCTNDLISLLG
                     PKVAQRVIIHFKLLFGFRHKPHIGTVDSWFWENFFMLELHKLWLTVVKHNRVTTDFFN
                     VVYEKIQNYKQYAIKTLRMSSKAVPAIQRLCLAKFKQQLLYLNIKVTVKKNKREMCLN
                     GFVYGKTLYVVESSQLIFRNLLLLYYDYSLPDECKTNEENVLTAHYIRVISRLSFKRS
                     RSALPPGVRPDFIFVAQQPKRKELPNVPGGIDFAEITSVRHGAVTLNAFNTNKVMNLK
                     ATISKRANFVYHRIPKTMTHSFVMYKHTFKEPAFTVSTFVSNDDLDMSSLNINIRGPY
                     CDFLYALGVYKMHVSIRDLFLPAFVCNSNNSVDLQGLENQDVVRNRKKKVYWITNFPC
                     MISNANKVNVGWFKAGTGIIPRVSGEDLQNVLLQELNNVREIPGLVFDMDLHQLLVLL
                     EQRNLHQIPFLVKQFLIFLRLGLLMGYGHSRRNKVHDIMLHLISNGLFDFNKNSVANT
                     KIKHGCALVGTRLANNVPKIIARQKKMKLDHMGRNANSLAVLRFIVKSGEQKNKTVFI
                     KLLEYLAETSTAINTRNEVARLLQTLTAKVKT"
     gene            96291..97343
                     /gene="U59"
     CDS             96291..97343
                     /codon_start=1
                     /gene="U59"
                     /product="U59"
                     /note="6R; similar to HHV-5 UL88"
                     /db_xref="InterPro:IPR007616"
                     /db_xref="UniProtKB/Swiss-Prot:P24438"
                     /protein_id="CAA58351.1"
                     /translation="MNVLVADEWFDCAIRLDSETIAVHEIFNPELSKLLNLHSKTVYM
                     SDLCAFISGCVNRNVGKLTIYWHVNGDIIYALTGILHCVKIKIECGERIADGRYRLYE
                     IPKLFLMRGQSTPMELKWKHAVGIATTNKPLLTHVLTDVLETSPFTLPDTLLSVQELS
                     IFRERLSYIYYVLGSDVDIVARTEREIFQKCAELARLQQVFLIQGNIMENFVLAQACL
                     FQLGADGLWEEISGSVRPRPELMSSAFIQHRVMLNNCYCIAVIFNAIYKHKLSLPTVE
                     RSHETVNRVAQEYYKSYVNAPLSVLVCATKVLTLFTEEYNFKSALVFVSQFFQVDVEA
                     SRADVIRLFLACLKGD"
     gene            complement(97340..102538)
                     /gene="U60/66"
     CDS             complement(join(97340..98467,101666..102538))
                     /codon_start=1
                     /gene="U60/66"
                     /product="U60/66"
                     /function="DNA packaging"
                     /note="7L; similar to HHV-5 UL89exon2, HVS GENE 29b, EBV
                     BDRF1, EHV1 44, VZV 42, HSV1 UL15EX2"
                     /db_xref="GOA:A0A2N9DYY6"
                     /db_xref="InterPro:IPR003498"
                     /db_xref="InterPro:IPR003499"
                     /db_xref="InterPro:IPR033663"
                     /db_xref="InterPro:IPR038435"
                     /db_xref="UniProtKB/TrEMBL:A0A2N9DYY6"
                     /protein_id="SPC53501.1"
                     /translation="MLRTCDITHIKNNYEAIIWKGERDCSTISTKYPNSAIFYKKRFI
                     MLTPELGFAHSYNQQVKPLYTFCEKQRHLKNRKPLTILPSLSHKLQEMKFLPASDKSF
                     ESQYTEFLESFKILYREPLFLQIDGFIKDFRKWIKGEFNDFGDTRKIQLEPFQKNILI
                     HVIFFIAVTKLPALANRVINYLTHVFDIEFVNESTLNTLKQKTNVFLVPRRHGKTWFI
                     VPIISFLLKNIEGISIGYVAHQKHVSHFVMKEVEFKCRRMFPEKTITCLDNVITIDHQ
                     NIKSTALFASCYNTHSIRGQSFNLLIVDESHFIKKDAFSTILGFLPQASTKILFISST
                     NSGNHSTSFLMKLNNSPFEMLSVVSYVCEDHAHMLNERGNATACSCYRLHKPKFISIN
                     AEVKKTANLFLEGAFIHEIMGGATCNVINDVLITEQGQTEFEFFRYSTINKNLIPFLG
                     KDLYVYLDPAYTGNRRASGTGIAAIGTYLDQYIVYGMEHYFLESLMTSSDTAIAECAA
                     HMILSILDLHPFFTEVKIIIEGNSNQASAVKIACIIKENITANKSIQVTFFHTPDQNQ
                     IAQPFYLLGKEKKLAVEFFISNFNSGNIKASQELISFTIKITYDPVEYALEQIRNIHQ
                     ISVNNYITYSAKKQACSDDLIIAIIMAIYVCSGNSSASFREI"
     gene            98479..98736
                     /gene="U62"
     CDS             98479..98736
                     /codon_start=1
                     /gene="U62"
                     /product="U62"
                     /note="8R; similar to HHV-5 UL91"
                     /db_xref="InterPro:IPR035385"
                     /db_xref="UniProtKB/Swiss-Prot:P24439"
                     /protein_id="CAA58354.1"
                     /translation="MNSALNGIKDDFENCETKDDLFKIIDKISKNCNFIVEQVESLPR
                     RVDSAAILFDNLAVEIFNDVIYRQNGVAAKIRQGNGQDIDT"
     gene            98684..99334
                     /gene="U63"
     CDS             98684..99334
                     /codon_start=1
                     /gene="U63"
                     /product="U63"
                     /note="9R; similar to HHV-5 UL92, HVS GENE 31, EBV BDLF4"
                     /db_xref="InterPro:IPR004289"
                     /db_xref="UniProtKB/Swiss-Prot:P24440"
                     /protein_id="CAA58355.1"
                     /translation="MELPRKYDRVTGRILTHKNNQMCTTECSQMYNLHNPITFELGLG
                     NVFVCMRCLTVHHCDMQTDCTIVNTHEGYVCAKTGLFYSGWMPAYADCFLEPICEPNI
                     ETVNVVVVLLSYVYSFLMENKERYAAIIDSIIKDGKFIKNVEDAVFYTFNAVFTNSTF
                     NKIPLTTISRLFVQLIIGGHAKGTIYDSNVIRVSRRKREDSLLKKMRLEYGNALIL"
     gene            99312..100640
                     /gene="U64"
     CDS             99312..100640
                     /codon_start=1
                     /gene="U64"
                     /product="U64"
                     /note="10R; similar to HHV-5 UL93, HVS GENE 32, EBV BGLF1,
                     EHV1 45, VZV 43, HSV1 UL17"
                     /db_xref="GOA:P24441"
                     /db_xref="InterPro:IPR007640"
                     /db_xref="UniProtKB/Swiss-Prot:P24441"
                     /protein_id="CAA58356.1"
                     /translation="METHLYYDTLYQYQGGVYPAHICLPTDVCLPMRVDCIESLYFRC
                     VFFKSGMHYTEWSKLKFTVISREIKFKDVLKDADSDEVFTGLVVMTIPIPIVDFHFDI
                     DSVILKLVYPRLVHREIVLRLYDLICVRPPSNRPSEASAKNIANDFYQLTSRENKQTP
                     DEEKRCLFFQQGPLEPPSTVRGLKAPGNEKPIQFPAHANEKMTESFLSDSWFGQKVRC
                     KKILDFTQTYQVVVCWYELSFSREMQIENNLLSASQLKRVNAADFWDRTNRYLRDIGS
                     RVLTHIVKTLQIHNRQFKQKFNCNFPDNFSFDRLLSFMQLGKDFWILNLTLDSCIIKA
                     IICFLGFQNGGKSFLAQDEVWGDLIDCSKGSVIYGEKIQWILDSTNNLYSTCREKQNK
                     SWELYVDCCALYVSEKLELDFVLPGGFAITGKFALTDGDIDFFNWRFGLS"
     gene            100597..101604
                     /gene="U65"
     CDS             100597..101604
                     /codon_start=1
                     /gene="U65"
                     /product="U65"
                     /note="11R; similar to HHV-5 UL94, HVS GENE 33, EBV BGLF2,
                     EHV 46, VZV 44, HSV1 UL16"
                     /db_xref="GOA:P24442"
                     /db_xref="InterPro:IPR004286"
                     /db_xref="UniProtKB/Swiss-Prot:P24442"
                     /protein_id="CAA58357.1"
                     /translation="MAISTFSIGDLGYLRNFLQNECNWFRICKKTFYREYRSVATSSP
                     TFSLNNKPKKFCMHCEIVIFKRSEEFMFSLAVNGIHFGQFLTGKMKFNKKAVPEGLYY
                     YILELGSITPIDLGFIPRYNSDCVTNMRCVTPEVIYENCSIVCPEEANRLTVKGSGDN
                     KLTPLGGCGAWCLKNGGDLYIYTFALAYDLFLTCYDKSTFPSLAKIIFDMIACESEDC
                     VFCKDHNKHVSQAGQIVGCVSNQETCFCYTSCKKKMANINNPELISLLCDQEINKIDI
                     MYPKIKASLSLDINSYAHGYFGDDPYALKCVNWIPVRISAALSRLIVLSCPVCKRVVM
                     D"
     gene            102510..103571
                     /gene="U67"
     CDS             102510..103571
                     /codon_start=1
                     /gene="U67"
                     /product="U67"
                     /note="13R; similar to HHV-5 UL95, HVS GENE 34, EBV BGLF3,
                     EHV1 48, VZV 46, HSV1 UL14"
                     /db_xref="InterPro:IPR004280"
                     /db_xref="UniProtKB/Swiss-Prot:P24444"
                     /protein_id="CAA58359.1"
                     /translation="MWVMSQVRSMEPDLTLAAVYQAAANLTEQDKEIFAEAVKTAFSV
                     CSSAAPSARLRMIETPTQNFMFVTSVIPSGVTSGEKKTKLNIDAALDNLALSFANKKS
                     KKMARTYLLQNVLRTQDQQVAISGKYILYTKKHIETSLMIDKTKLVKKILEYAETPNL
                     LGYTDVRDLECLLWLVFCGPKSFCQSDSCFGYSKTGYNAAFPNLLPPYLYECGQNNGL
                     FFGIVQAYVFSWYSDFDFSALEISERARRRIRSLLYDLKQKFAEQEVSVLSVASQMCI
                     FCALYKQNKLSLEYVSGDLKTSVFSPIIIKDCLCAQTTISTTQMLPGTKSSAIFPVYD
                     LRKLLGALVISEGSVKFDI"
     gene            103571..103915
                     /gene="U68"
     CDS             103571..103915
                     /codon_start=1
                     /gene="U68"
                     /product="U68"
                     /note="14R; similar to HHV-5 UL96, HVS GENE 35, EBV
                     BGLF3.5"
                     /db_xref="InterPro:IPR020160"
                     /db_xref="InterPro:IPR022614"
                     /db_xref="UniProtKB/Swiss-Prot:P24445"
                     /protein_id="CAA58360.1"
                     /translation="MSLKDYLRQSISKDLEVRHRDSLKIRLGERHPLSVHQHMIAARQ
                     IIKSDNAEQQHVISSLSGFLDKQKSFLRVQQKALKQLEKLDVDEIIDTAAEVKAVSND
                     IKETLITSTELE"
     gene            103918..105606
                     /gene="U69"
     CDS             103918..105606
                     /codon_start=1
                     /gene="U69"
                     /product="ganciclovir kinase"
                     /function="phosphotransferase, ganciclovir kinase"
                     /note="phosphotransferase; 15R; similar to HHV-5 UL97, HVS
                     GENE 36, EBV BGLF4, EHV1 49, VZV 47 HSV1 UL13"
                     /db_xref="GOA:P24446"
                     /db_xref="InterPro:IPR008266"
                     /db_xref="InterPro:IPR010615"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/Swiss-Prot:P24446"
                     /protein_id="CAA58361.1"
                     /translation="MDNGVETPQGQKTQPINLPPVRKKLRKHEGLGKGVKRKLFAEDS
                     SPLKKQISACSDMETLSSPVKSECESRSASLDESFGKCKHEIACDCSAIEELLCHESL
                     LDSPMKLSNAHTIFSSNKWKLELEKIIASKQIFLDMSENAELAAYGETLCNLRIFEKI
                     SSPFLFDVQSEERSYSVVYVPHNKELCGQFCQPEKTMARVLGVGAYGKVFDLDKVAIK
                     TANEDESVISAFIAGVIRAKSGADLLSHECVINNLLISNSVCMSHKVSLSRTYDIDLH
                     KFEDWDVRNVMNYYSVFCKLADAVRFLNLKCRINHFDISPMNIFLNHKKEIIFDAVLA
                     DYSLSEMHPNYNGTCAIAKEYDKNLQLVPISRNKFCDMFNPGFRPLVANAMILVNVCG
                     AFDGENNPLRHCNLDLCAFAQVVLSCVLRMTDKRGCREAQLYYEKRLFALANEACRLN
                     PLKYPFAYRDACCKVLAEHVVLLGLLFYRDVVEIYEKLYDFLDERGEFGSRDLFEATF
                     LNNSKLTRRQPIREGLASLQSSEYGEKLLHDLRELFLINSTADLDKDTSSLFHM"
     gene            105614..107080
                     /gene="U70"
     CDS             105614..107080
                     /codon_start=1
                     /gene="U70"
                     /product="alkaline exonuclease"
                     /function="alkaline exonuclease; DNA procession"
                     /note="16R; similar to HHV-5 UL98, HVS GENE 37, EBV BGLF5,
                     EHV1 50, VZV 48, HSV1 UL12"
                     /db_xref="GOA:P24447"
                     /db_xref="InterPro:IPR001616"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="InterPro:IPR011604"
                     /db_xref="InterPro:IPR034720"
                     /db_xref="UniProtKB/Swiss-Prot:P24447"
                     /protein_id="CAA58362.1"
                     /translation="MDLDQISETLSSVAEEEPLTMFLLDKLYAIREKIKQVPFSIVRL
                     CHVYCMLIKYNASNNNCILGRKLIEEMQQFLCGTRVDGSEDISMDLSELCKLYDYCPL
                     LCSALCRAPCVSVNKLFKIVERETRGQSENPLWHALRKYTVTATKLYDIYTTRCFLEY
                     KGQQFFGEAVIYGAKHERVIRHLVATFYVKREVKETLGLLLDPSSGVFGASLDACFGI
                     SFNEDGFLMVKEKALIFEIKFKYKYLRDKEDHFVSELLKNPTEKSFSDFILSHPVPVI
                     EFRERGKIPSSREYLMTYDFQYRPQRKLRTCPTPAILAPHIKQLLCLNETQKSTVIVF
                     DCKSDLCEQKLSVFQKAVFTVNVFVNPKHRYFFQSLLQQYVMTQFYINDHNNPEYIES
                     TEVPSVHIVTAFFRRRTEEERSLHLVIDETEYIEEEIPLALIVTPVAPNPEFTCCVIT
                     DICNLWENNICKQTSLQVWAQSAVNQYLAACVRKPKTP"
     gene            107017..107250
                     /gene="U71"
     CDS             107017..107250
                     /codon_start=1
                     /gene="U71"
                     /product="U71"
                     /function="myrstilated virion protein?, phosphoprotein?"
                     /note="17R; positional similar to HHV-5 UL99, pp28k"
                     /db_xref="GOA:P24448"
                     /db_xref="InterPro:IPR020170"
                     /db_xref="InterPro:IPR034705"
                     /db_xref="UniProtKB/Swiss-Prot:P24448"
                     /protein_id="CAA58363.1"
                     /translation="MGAKCCKPVSCGMCKKTENTLIDYKGNPILLANEFTVLTDTESE
                     EEGMADLEKPLLEKVVAKCDTEAEKKLPCKSKK"
     gene            complement(107330..108364)
                     /gene="U72"
     CDS             complement(107330..108364)
                     /codon_start=1
                     /gene="U72"
                     /product="integral membrane protein"
                     /function="integral membrane protein; associates with
                     glycoprotein gN"
                     /note="glycoprotein M; gM; 18L; similar to HHV-5 UL100,
                     HVS GENE 39, EBV BBRF3, EHV1 52, VZV 50, HSV1 UL10"
                     /db_xref="GOA:Q04630"
                     /db_xref="InterPro:IPR000785"
                     /db_xref="UniProtKB/Swiss-Prot:Q04630"
                     /protein_id="CAA58364.1"
                     /translation="MASSRVDTINLRIWLVSIICAALSFINVTVYLIAINFPNLGFPC
                     AYFEINDLKAVNLSANNQIYQMTHQLYINPVQIICYVLIMAMLFLLIIIYYIVCCAKV
                     FSSNKTSNVNQTTRDITWMGDTSSCFQFILIMDTFQLFVTALSFRLVALGAFAYCIFF
                     VCFTTFNVTLITQFQSADKSFFAFQKIHPNLKGTVQFKTVVINLTELMLGYSTMFLGI
                     TTCLGVGNSIYIRSITVAYSSINTFLVMACIYSIVIEAVLVRYVKPLFGYYVGMFCGA
                     VGLSFPILQYETFFESEWSTGLIINLAVIAIISIGFIICRLVRYLVKKKRRYKQLVNT
                     ESSSLMDENE"
     gene            108377..110719
                     /gene="U73"
     CDS             108377..110719
                     /codon_start=1
                     /gene="U73"
                     /product="origin-binding protein"
                     /function="origin binding protein"
                     /note="DEAD-like helicases superfamily, CRISPR/Cas
                     system-associated protein Cas3; Region: Cas3; cd09639;
                     19R, HDRF0; similar to EHV1 53, VZV 51, HSV UL9"
                     /db_xref="GOA:P52378"
                     /db_xref="InterPro:IPR003450"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/Swiss-Prot:P52378"
                     /protein_id="CAA58365.1"
                     /translation="MENRFQNDTLFSEWFGQSLSDVRFPDNVTVYSQADSAVSFENVR
                     QPIKLVRAAMGSGKTTALIHFLKQVPRELSVLLISCRKTFAAEILHRFTLNGLKDFEL
                     YCDITERQINNRKVIVQIESLHRLTENYDVLILDEIMSIIKQFYSKTMTKTKEVDCKF
                     LSLIKNSSHVIAMDATLTRHVVEFFAAFKPDTQIALIRNTFVSAMFSNRIAYFCDTFF
                     GKEFSFFARLEDKLRWDKKLCLFCSTVLAAEYMYDLIRSRFPLKKVLLLTSKQGKCSS
                     IESWIRYDVVIYTSVVTVGLSFEPVYFSSLFVYIQLAKGGPDMVSVFQSIGRVRRVID
                     EDIYIYMNPVLIRSYDPLAPIAIPPCSDWSVAEQSIISESCIDFRGKCSGAHKYNFCS
                     VLKSLFRYRHYIEKTTITSLSDSLFLLCSLLCENSIKVDIVGNGFPMRKEVFLSFLQI
                     LVEECHFIEKKITLPGDDMTFQEIISSRETIMNGDFYENGDQLLHKDYITDMGKFRAT
                     FLSPGVDIFIASDIVYDLKNESKRYVFVNVWLQKCVSAGVESTEIERVFCERIKCYML
                     PKSFLCDEYFVLGDISGVYEWGMLIDLAFLAEMIRKDLKLKSCTDTTTDISEDDLLLC
                     AARRSSDILQIMQLVFTVHVQFFQKYSLQTLQLFNKLRGMRIVTGVFSIEKFSISILR
                     LFFKCAFNMTLSASRPRYIPGKAYRNLTKNDMENMLDNWEISRTNLKTCKELRKALTE
                     ASRARRKQTIYKLQGSDISLSVSEVGVFGQHASPGVCVSS"
     gene            110688..112676
                     /gene="U74"
     CDS             110688..112676
                     /codon_start=1
                     /gene="U74"
                     /product="helicase/primase complex"
                     /function="replication, helicase/primase complex"
                     /note="HDRF1; part of helicase/primase complex, similar to
                     HHV-5 UL102, HVS GENE 41, EBV BBLF3, EHV1 54, VZV 52, HSV1
                     UL8"
                     /db_xref="GOA:P52375"
                     /db_xref="InterPro:IPR004996"
                     /db_xref="UniProtKB/Swiss-Prot:P52375"
                     /protein_id="CAA58366.1"
                     /translation="MHLRGCACHLSLYCVYNDWENKIYRVPIFQCLFLEAETRSLKTF
                     LIRGQSLDQESLNEIEVTRKETMLWDLQEQSNMMDKKIAAISNLIMNNGELVRTLSKF
                     FVPLTVVLGDDGLEILEAYVCGEELMLPLDTVPVILRCIGDYAALDTKHLLSNECTQA
                     SKKIRFGYSVMDFHFSLTVSDVKICFSHTDTGEAVCEKMKQIFSFSVCAFGGEQVLLV
                     TPKNAYALLFDDDLCLLLLQSVFAFLHEKIFGVYKQVLVQLCEYIGPDLWPFGNERSV
                     SFIGYPNLWLLSVSDLERRVPDTTYICREILSFCGLAPILGPRGRHAVPVVRELSIEM
                     PGSETSLQRFRFNSQYVSSESLCFQTGPEDTHLFFSDSDMYVVTLPDCLRLLLKSTVP
                     KAFLPCFDENATEIDLLLKFMSRLQHRSYALFDAVIFMLDAFVSAFQRACTLMGMRWL
                     LVRDLHMFYLTCDGKDTHVVMPLLQTAVENCWEKTTEIKQRPTFQCAEISRCGFIVYA
                     RFFLSSGLSQSKEAHWTVTASKYLSACIRTNKTGLCFASITVYFQDMMCVFIANRYNV
                     SYWIEEFDPNDYCLEYHEGLLDCSRYTAVMSEDGQLVRQARGIALTDKINFSYYILVT
                     LRVLRRWVESKFEDVEQTQFIRWENRMLCEHIHLLHLN"
     gene            complement(112711..113460)
                     /gene="U75"
     CDS             complement(112711..113460)
                     /codon_start=1
                     /gene="U75"
                     /product="U75"
                     /note="HDLF2; similar to HHV-5 UL103, HVS GENE 42, EBV
                     BBRF2, EHV1 55, VZV 53, HSV1 UL7, virion morphogenesis"
                     /db_xref="GOA:P52456"
                     /db_xref="InterPro:IPR002600"
                     /db_xref="UniProtKB/Swiss-Prot:P52456"
                     /protein_id="CAA58367.1"
                     /translation="MKSLKKLKELETSDVFNILHVRTILKVIKIDKCISLARHPLVNI
                     TVGDDGIWFHLEDGTMINGLEYKTICEKELGFQGFIGIIILDSEDTLQELRLNPFQFK
                     RRLIHMKVDTPEEFMLCGLVFALENLPLKQSTLHKLIAKLVLFPALSPITKILFNTCD
                     TLVCTLRHIFFNEHASEILHKVPLMIRLYNEMKNTHIEVLELYFNTKRSHNFINLSLE
                     SRQLQDSSLQVIQLATQFAQTFYSKNGDTSS"
     gene            complement(113369..115309)
                     /gene="U76"
     CDS             complement(113369..115309)
                     /codon_start=1
                     /gene="U76"
                     /product="U76"
                     /function="possible virion protein"
                     /note="HDLF1; similar to HHV-5 UL104, HVS GENE 43, EBV
                     BBRF1, EHV1 56, VZV 54, HSV1 UL6, DNA encapsidation"
                     /db_xref="GOA:P52453"
                     /db_xref="InterPro:IPR002660"
                     /db_xref="UniProtKB/Swiss-Prot:P52453"
                     /protein_id="CAA58368.2"
                     /translation="MMWRNQSSGRRPSKRLSDNEATLSTINSILGAEDMLSKNLLSYL
                     PPNNEEIDMIYPSEQIMTFIEMLHGHKNFFKGQTIHNALRDSAVLKKQIAYGVAQALL
                     NSVSIQQIHDEWKRHVRSFPFHNKKLSFQDYFSVWAHAIKQVILGDISNIINFILQSI
                     DNSHYNRYVDWICTVGIVPFMRTTHTAPNLYNLLQQVSSKLIHDIVRHKQNIVTPVLL
                     GLSSVIIPDFHNIKIFRDRNSEQISCFKNKKAIAFFTYSTPYVIRNRLMLTTPLAHLS
                     PELKKHNSLRRHQKMCQLLNTFPIKVLTTAKTDVTNKKIMDMIEKEEKSSDAKKSLIK
                     FLLNLSDSKSKIGIRDSVEGFIQEITPSIIDQNKLMLNRGQFRKRSAIDTGERDVRDL
                     FKKQIIKCMEEQIQTQMDEIETLKTTNQMFERKIKDLHSLLETNNDCDRYNPNLDHDL
                     ENLSLSRALNIVQRLPFTSVSIDDTRSVANSFFSQYIPDTQYADKRIDQLWEMEYMRT
                     FRLRKNVNNQGQEESITYSNYSIELLIVPFLRRFLNIYNLESIPEEFLFLSLGEILLA
                     IYESSKIKHYLRLVYVRELNQISEVFNLTQTHPENSEPIFDSNIFSPNPENEILEKIK
                     RIRNLRRIQHLTRPNYPKGDQD"
     gene            115152..117626
                     /gene="U77"
     CDS             115152..117626
                     /codon_start=1
                     /gene="U77"
                     /product="helicase"
                     /function="replication"
                     /note="HDRF2; part of helicase/primase complex; similar to
                     HHV-5 UL105, HVS GENE 44, EBV BBLF4, EHV1 57, VZV 55, HSV1
                     UL5"
                     /db_xref="GOA:P52356"
                     /db_xref="InterPro:IPR003840"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR034711"
                     /db_xref="UniProtKB/Swiss-Prot:P52356"
                     /protein_id="CAA58369.1"
                     /translation="MSISSLFGGRYDNKFLLNMSSAPKIELIVDKVASLSERRLEGRL
                     PEDWFRHIMDPETEFNSEFADALCIGIDEFAQPLPFLPFKALLVTGTAGAGKTNSIQT
                     LAANLDCIVTATTSIAAQNLSVVLNRSKSAQVKTIFKTFGFNSSHVSMSERQSYIAND
                     ERSIQIQQKQDLSIYWNVISDIADRALGAVACKTKELPDLCESSVIVIDEAGVILRHI
                     LHTVVFFYWFYNALYKTPLYEDGIVPCIVCVGSPTQSNALVTSFNPLTQNKDVKRGID
                     VLSALICDDVLSKYCEVDNNWIIFVNNKRCADHAFGDFLKHIEFGLPLKPELIEYVDQ
                     FVKPASYIRNPMNEIETTRLFLSHNEVKNYFRSLHEQVEVTNRNNLFVFPVYFLIKNK
                     TFEDYKSEIGNFSLEIEPWFKSNIHRLNTYSQFADQDLSKTVQLEEIVLEDGSVEETL
                     ITCHLKHIRNSSIGVTSKIKASTVGFSGTYEKFVELLQSDLFIEKTSCDQTIHAYSFL
                     SGLMFGGMYSFCCSKFTTPEVLMEIKNIKMPSIEFLESEMSRMSPDVQTVETDERYDF
                     GLVNDGLSDVDLLEIDPCGDPFFTRYSKLPLTNSLSFEEISLLYTTFKDIFISRFAIL
                     QKHTKGKFGKTLLVTYNRNNVSRKQCGEIYSHLKSFYGMLTYAIPANNYTLEGYTNDN
                     VVHLGTDKQLPQILYKKGLPRLVIKDEMGFISVLDNNVSKFIDVVNGQSFHLCTTVDY
                     ATVSKVSMTITKSQGLSIQKVAIDFGSDPKNLKLSSIYVGMSRVTDPNNLIMNVNPLR
                     LNYENDNFIAPHIVKALKNENTMLIF"
     gene            120216..121818
                     /gene="U79"
     CDS             join(120216..120846,120943..121139,121222..121818)
                     /codon_start=1
                     /gene="U79"
                     /product="putative replication protein"
                     /function="possible replication protein"
                     /note="EDRF1; similar to HHV-5 UL112/113, spliced in vitro
                     replication protein"
                     /db_xref="GOA:P52529"
                     /db_xref="InterPro:IPR004138"
                     /db_xref="UniProtKB/Swiss-Prot:P52529"
                     /protein_id="CAA58371.2"
                     /translation="MYAEERAYGSFDDVMEVYQQIVTESIQLKRLHFGSGCLIEFLGD
                     SGTCETFCGGWISMICWTSDTNSMGSLTVDIGIDDGKYKTYNARGFLLCSKSITSISQ
                     NTEGRDRILTVSQENNKLQITFVTLTKVFKEHDIRNLGDPKCIEKFEKECRALDRKKH
                     DDEHRKRSGKQKEKRKVEDTDKKKDDDRRKQEERKRNDEDKQPDKKEESDELPKEKRQ
                     KYHDMKRNLEEQSHEDGITLTSTTLVNGAVEGALPPCISIDNHEDQQHDELDKRAYAQ
                     GTNREGLSNEDNYGNFRLNKSLEQLRAKLVASSGDIVERSLLKLKECLDNVKDNLIKN
                     ECADVTGPSKCLSKTKHIEPKKQIVFSDCVRPVPVCEIKPFIDVRLFETARSPRRLRQ
                     RTRTIVGSTDGAIEQQRVISGQNRGRARGRGRGRAPRRRNSNINNSRTQTTIVIDDSS
                     EAENFENEGSFNEDLLATTILETL"
     gene            complement(121862..122629)
                     /gene="U81"
     CDS             complement(121862..122629)
                     /codon_start=1
                     /gene="U81"
                     /product="uracil-DNA glycosylase"
                     /function="uracil-DNA glycosylase"
                     /note="EDLF4; similar to HHV-5 UL114, HVS GENE 46, EBV
                     BKRF3, EHV1 61, VZV 59, HSV1 UL2"
                     /db_xref="GOA:P52345"
                     /db_xref="InterPro:IPR002043"
                     /db_xref="InterPro:IPR005122"
                     /db_xref="InterPro:IPR018085"
                     /db_xref="InterPro:IPR036895"
                     /db_xref="UniProtKB/Swiss-Prot:P52345"
                     /protein_id="CAA58330.1"
                     /translation="MALLQWMLDHVQDEEKNCENLSIDDQHSLFGINRDWLSFLQLSK
                     LEITHLKHVYKLVDNDRAHLMVHPSSDNVHAWSFLCKPDNVKVVILGQDPYPDGRGCG
                     LAFGTVKECSIPESLKNIFKELERSVPNFSPPDNGCLNSWCSEGVLLLNSIFTVVHGL
                     PMSHEAFGWQTLSYKIISKLSVEMDSLVFLLWGNHARKLSYLIDARKHLVLESAHPSP
                     KVKSARMPFIGCNHFVRANLFLTEHGKDPINWNILNE"
     gene            complement(122705..123457)
                     /gene="U82"
     CDS             complement(122705..123457)
                     /codon_start=1
                     /gene="U82"
                     /product="glycoprotein L"
                     /function="glycoprotein L, gL, gH/gL complex, infection,
                     cell fusion"
                     /note="gL; EDLF3; gH (U48) and gL form a heterodimer
                     (gH/gL complex, this complex forms different heterotrimers
                     gH/gL/gO or gH/gL/gQ); similar to HHV-5 UL115, HVS GENE
                     47, EBV BKRF2, EHV1 62, VZV 60, HSV1 UL1"
                     /db_xref="GOA:P52508"
                     /db_xref="InterPro:IPR002689"
                     /db_xref="UniProtKB/Swiss-Prot:P52508"
                     /protein_id="CAA58331.1"
                     /translation="MELLLFVMSLILLTFSKAIPLFNHNSFYFEKLDDCIAAVINCTK
                     SEVPLLLEPIYQPPAYNEDVMSILLQPPTKKKPFSRIMVTDEFLSDFLLLQDNPEQLR
                     TLFALIRDPESRDNWLNFFNGFQTCSPSVGITTCIRDNCRKYSPEKITYVNNFFVDNI
                     AGLEFNISENTDSFYSNIGFLLYLENPAKGVTKIIRFPFNSLTLFDTILNCLKYFHLK
                     TGVELDLLKHMETYNSKLPFRSSRPTILIRNT"
     gene            123580..123873
                     /gene="U83"
     CDS             123580..123873
                     /codon_start=1
                     /gene="U83"
                     /product="U83"
                     /function="CC chemokine; immune regulation"
                     /note="EDRF3"
                     /db_xref="GOA:P52460"
                     /db_xref="InterPro:IPR035347"
                     /db_xref="UniProtKB/Swiss-Prot:P52460"
                     /protein_id="CAA58332.2"
                     /translation="MAIGFICSSPDAELFSEKSRMSSSVLLGCLLCCMDWSAAVPGKT
                     EPFRKLFDAIMIKKLKSCSAAYPSDLEQGSMCDMADASPTSLELGLSKLDKES"
     gene            complement(123977..125005)
                     /gene="U84"
     CDS             complement(123977..125005)
                     /codon_start=1
                     /gene="U84"
                     /product="U84"
                     /note="EDLF2; similar to HHV-5 UL117, spliced in HHV-5"
                     /db_xref="GOA:P52532"
                     /db_xref="InterPro:IPR005028"
                     /db_xref="UniProtKB/Swiss-Prot:P52532"
                     /protein_id="CAA58333.1"
                     /translation="MKDRGNKNTSKTRQTVKSRRTRKTTKQFVERKKNLSAKTTIRNN
                     RLQNNLSPQTTPTEKPVDYATARVFPQHTPYDIKFNKEKYRNNEIYAYSKLRKISNAV
                     FRQEKEINRLTVFTDKPLADLSFKMPVNTSTTEKKEIVRSTECQRQDRNTVNAFKIFQ
                     SYETSPPYSPCSPKNFMSEIYRLFRCYNASIVQIQVYSRNKILINAMQEKLMSIGNMV
                     INVGEQIISESVHHEPVVAIAINQFFRGTVPQTDALRKNAVTPIPVNASKKKLVGICS
                     LMINAPTEKDLLCAAHVCINFAICYPNEITLNIAKLTQPMLLQEHITIYNSFNKYIYW
                     DDYGKLLN"
     gene            complement(125033..125905)
                     /gene="U85"
     CDS             complement(125033..125905)
                     /codon_start=1
                     /gene="U85"
                     /product="U85"
                     /function="immune regulation"
                     /note="type 1 membrane protein; contains a signal peptide;
                     IgG Fc-binding; similar to OX-2; possibly UL120 family;
                     EDLF1; OX-2; immunoglobulin superfamily, V and C chain
                     domains"
                     /db_xref="GOA:Q89738"
                     /db_xref="InterPro:IPR007110"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR036179"
                     /db_xref="UniProtKB/Swiss-Prot:Q89738"
                     /protein_id="CAA58334.1"
                     /translation="MSSLMLRLLPLLYIISAHFVLHPETSPSLIYEIGSIVTFHCRLE
                     TTTNIRSVSWYNKNRLISNHEVQNMDNLSFTDDGYVLIHELNKINNLAVDSKLYFHIK
                     HNRTTSLLKIKAKSAYDATCLTCTFTVDNEKTSATSCLKLFMKPIVVLYFRYLDNFLD
                     VTCTVTSYPKPNVVIKFLGEVYKRDIPIVRQNENGSSTVSVNFTFKRRTKLEFVGKTV
                     SCLASSWFTNQKASALVTSGEHTVQNHDEYSKEGVKSSNSDETVFTWTVPLILILISV
                     IVLLISVCIVAFKS"
     gene            complement(126041..136166)
                     /gene="U86"
     CDS             complement(join(126041..130146,135826..136019,
                     136108..136166))
                     /codon_start=1
                     /gene="U86"
                     /product="immediate early protein IE2"
                     /function="transactivation"
                     /note="BCLF1; similar to HHV-5 UL122, IE2; region IE-A,
                     immediate early gene"
                     /db_xref="GOA:Q77Z83"
                     /db_xref="InterPro:IPR005028"
                     /db_xref="InterPro:IPR005507"
                     /db_xref="InterPro:IPR026075"
                     /db_xref="PDB:5WX8"
                     /db_xref="UniProtKB/Swiss-Prot:Q77Z83"
                     /protein_id="CAA58335.2"
                     /translation="MEPAKPSGNNMGSNDERMQDYRPDPMMEESIKEILEESLMCDTS
                     FDDLIIPGLESFGLIIPESSNNIESNNVEEGSDGELKTLAEQKCKQGNDNDVIQSAMK
                     LSGLYCDADITHTQPLSDNTHQDPIYSQESRIFSKTIQDPRIVAQTHRQCTSSASNLQ
                     SNESGSTQVRFASELPNQLLQPMYTSHNQNANLQNNFTSLPYQPYHDPYRDIESSYRE
                     SRNTNRGYDYNFRHHPYRPRGGNGKYNYYNPNSKYQQPYKRCFTRTYNRRGRGHRSYD
                     CSDRSADLPYEHYTYPNYEQQNPDPRMNNYKDFTQLTNKFNFESYDYSMAFSTDSTHV
                     QSDNYNHPTKAQTIPETTKTKKHEATKDNETSTENQVLTPDVISLSYRPSSYKMDIIK
                     KIYDTDVIPLPKEALTANGSNRDVDIQKYKKAHIRCRSVQKKKERSSQTNKHDENHAS
                     SRSDLKERKSNENEDKAVTKARDFSKLNPLLSPLPLTPEPAIDFADHTDKFYSTPEFN
                     QIQQNLHRSKTSLQDTVPISKHTPRAPTKDNSYKKHHDSKDNYPKMKHSPGRTTSKKN
                     TTNSNGHQNFKEVSVKNVSGKATSTSPKSKTHHYSSSSDEEGQYKSPVKTIIQSPSPY
                     CKLKNPSIMDKNSAKNHTASADKNLTDNSPIRSNLNPTAFNKSNSNKSITNSTSNSDE
                     CTDRKPNCNSTKNESKDPNRTCGKNSDKHLSKSCTMASKRAPSRASSRASSRDSSRAS
                     SRASSRASSRDSSRASSRASSRDSSRASSRASSRASSKASSRASSRASSRASSRDSSR
                     ASSKASSRASSRDSSRASSRDSSRDSSRASSRASSRDSSRASSKASRKASSRASSRAS
                     SRASSKASGKASSEASSRASSRNSSRASSRASSRASSRDSSRASSRASSRDSSRASSK
                     ASRKASSRASSRASSRELRQIYCDSNKRQTPPHDTSINTKFEISEIKFRCGEDLNFYK
                     NTAARLQCFNHNDQFYNPRFRPHIRTNRKKSESTNDTDSESSMSRCKSHCRNSPDSLT
                     VVRRKKHKSGSSSISSSIEENCRSNSHIVTGKEKFTPFYYQSSRTRSSSSSSSSSASL
                     SCSKSTLKTCRKTQYKDNKQIKSKSDSKHKTTNMSSDYESNRHADVFKNSPEAGEKFP
                     LHNSSPFNTHEQSNHSENAIDEEQKKAPNITTSHLQGKQNVRLHNTKKCKKKRPRDDD
                     SDSSIKNFCKKRISGAQKTESEVSEPDDLCYRDYVRLKERKVSEKFKIHRGRVATKDF
                     QKLFRNTMRAFEYKQIPKKPCNEKNLKEAVYDICCNGLSNNAAIIMYFTRSKKVAQII
                     KIMQKELMIRPNITVSEAFKMNHAPPKYYDKDEIKRFIQLQKQGPQELWDKFENNTTH
                     DLFTRHSDVKTMIIYAATPIDFVGAVKTCNKYAKDNPKEIVLRVCSIIDGDNPISIYN
                     PISKEFKSKFSTLSKC"
     repeat_region   127549..128233
                     /rpt_type=TANDEM
                     /note="R1; encodes SR repeats"
     repeat_region   131077..131854
                     /rpt_type=TANDEM
                     /note="R2; TG degenerate repeats"
     gene            complement(133146..136166)
     CDS             complement(join(133146..135718,135826..136019,
                     136108..136166))
                     /codon_start=1
                     /gene="U90"
                     /product="immediate early protein IE1"
                     /function="transactiviation, immediate early, IE1; PML
                     SUMO-1 interaction nuclear phosphoprotein"
                     /note="pRF3/4, RF2; positional similar to HHV-5 IE1,
                     transactivator; region IE-A"
                     /db_xref="InterPro:IPR005507"
                     /db_xref="UniProtKB/Swiss-Prot:Q69567"
                     /protein_id="CAA58339.2"
                     /translation="MEPAKPSGNNMGSNDERMQDYRPDPMMEESIKEILEESLMCDTS
                     FDDLIIPGLESFGLIIPESSNNIESNNVEEGSDGELKTLAAQSAGNCIQSIGASVKAA
                     MKQEQSDMEDKLIKCAGLLTQQQSMFIGLGLEQLSQLININLLSSASTKYVESYSKML
                     HGKELDFFNWCEPRFIVFACDKFDGLVKKVASESRNLLLDLRANMNNDIIKAVKDIFS
                     KATVTLDCQKLNQGATMLMMMAHNKEMSNPDISSKDFCEKINTLKQTLLEGKNEIVET
                     NAKNMQILQTFAIKQMNQIFMDGCDKAFLKLNVNCKNLITAAKNLANTILQSIVICSN
                     EFSWQHLKLLRRGFKVTMLNMITQACECLESDYDDTGLIKPLTPLQIMDGYINMNKNR
                     QSSICDGNTDPSDSMILDLADFDDHGRYSEESSIESIHEDDDNKMYPCTPSPEVPGKS
                     KYVGTFTENSRQSGDEQTNPNCVGTASVTDLGGPDNLNSISGLQSCKNMLLERLLDTQ
                     CDSVVEGTEQDGSYGNTLISEMMMFGYETDHSAPYESESDNNDEIDYIANSDSAARTN
                     NIHMNSTDENTPFSNSICSPPEVTPSKKNVKPKSMTPGSKPKKRVAKRKHVSSKSPKN
                     KKIKTDQLPKAADVIVISSESEDEEDGDNIIGNSILIKAIKSESDSESSSESNDCTSE
                     HKQLHLSDYDEVTNNGHCPSYGFPTPVFTIPIRSMQGTGGIKSKFIPKKNWIWYMKKT
                     HQVDNCPIHNSENVDAKDDSDGTEAKHCFMNHFVPIKTDDEDYDKNNVSYIYNKIQNS
                     KIDSGDIIPTKKLIIDMVMDNFMDLNDIIKQGITKHCQDLCNKYNVVTPTTCEDDLNM
                     TNSQTFATTATQVFDPPVTGNNSSILNIINDTTSQNDENRCTEGTSNSNEKCTNISDC
                     NSDGTEAFKLDGYPSDYDPFVENAQIY"
     gene            136321..136884
     CDS             join(136321..136531,136634..136884)
                     /codon_start=1
                     /gene="U91"
                     /product="U91"
                     /function="antisense transcription regulation?"
                     /note="spliced antisense IE1; region IE-A"
                     /db_xref="GOA:Q69569"
                     /db_xref="UniProtKB/Swiss-Prot:Q69569"
                     /protein_id="CAA58340.2"
                     /translation="MGKKSSTGTGKTNLKILACLLLIFLMATIFLLILEIISGQRYSN
                     DDSEGVTAALKHVSTPTTNCTETTTPDSVTSQAMENKESMKKNEGEPPVWIQALTTTL
                     SIILLVCIIMACIICSRTTEEEKSEMQSSASSVETLQSLNEAIFPKGEMNV"
     repeat_region   140076..140951
                     /rpt_type=TANDEM
                     /note="R3"
     gene            complement(141449..142921)
                     /gene="U94"
     CDS             complement(141449..142921)
                     /codon_start=1
                     /gene="U94"
                     /product="Rep"
                     /function="transactivation, replication inhibition, helper
                     for parvovirus replication"
                     /note="HCLF2; similar to parvovirus AAV2 Rep 68/78"
                     /db_xref="GOA:Q00683"
                     /db_xref="InterPro:IPR001257"
                     /db_xref="InterPro:IPR014835"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/Swiss-Prot:Q00683"
                     /protein_id="CAA58343.1"
                     /translation="MFSIINPSDDFWTKDKYIMLTIKGPMEWEAEIPGISTDFFCKFS
                     NVSVPHFRDMHSPGAPDIKWITACTKMIDVILNYWNNKTAVPTPAKWYAQAENKAGRP
                     SLILLIALDGIPSATIGKHTTEIRGVLIKDFFDGNAPKIDDWCTYAKTKKNGGGTQVF
                     SLSYIPFALLQIIRPQFQWAWTNINELGDVCDEIHRKHIISHFNKKPNVKLMLFPKDG
                     INGISLKSKFLGTIEWLSDLGIVTEDAWIRRDIRSYMQLLTLTHGDVLIHRALSIAKK
                     RIRATRKAIDFIAHIDTDFQIYENPVYQLFCLQSFDPILAGTILYQWLSHRGGKKNTV
                     SFIGPPGCGKSMLTGAILENIPLHGILHGSLNTKNLRAYGQVLVLWWKDISINFDNFN
                     IIKSLLGGQKIIFPINENDHVQIGPCPIIATSCVDIRSMVHSNLHKINLSQRVYNFTF
                     DKVIPRNFPVIQKDDINQFLFWARNRSINCFIDYTVPKIL"
     gene            142996..146361
                     /gene="U95"
     CDS             142996..146361
                     /codon_start=1
                     /gene="U95"
                     /product="U95"
                     /function="GRIM19 interaction, mitochondria damage"
                     /note="HCRF2; similar to MCMVIE2, similar to HHV-5 UL28,
                     HHV-5 US22 gene family"
                     /db_xref="UniProtKB/Swiss-Prot:Q89882"
                     /protein_id="CAA58344.1"
                     /translation="MSAHPDDLFWQQILNMDPTELLSDDVISSTCDENTAAGTDIMQP
                     LCVDMSVQPTTSGCHTGAMMSDSYFSNDTPDQNCQSHSTLTDLSPEDMNNQINVQPNQ
                     MTFQPISPPIQDQNYGYSNNMINPIKPASIIKLHGHSIGEMTVTDPSSHVNAQHFVQQ
                     SNPKFFLNMYPCMTANSQGPGECQSVHNQSSGSGSNSYDINTAPRDEWIFTTSGGESW
                     VLKRNTPNPPNSRTNLIFNNAQPIFHTQPQVSGFSDCSYQGGGLNSREYVNLAGYTPV
                     CNMQNIKNSWATQLGASIDCMTASPTGIDANVNSAFQPVGVVSNNRGANVSMGGMGNY
                     IENNSPWNQYYKSEMANNSINVKESNVYGHVGCVNDAISDKQGGTANVPSSLLNPDHQ
                     DWMRMTGTNTHMLNNINTNTEMENYDFPENDGNVHGATGVDLSTLSNGQQHSAFEGNG
                     TFPVVNTGNPRTTLNCAPQLFLLGGNPTIAHPMNGNNETPDKNVCKPTPSTGVIKKLN
                     FDGVDRGGGIGNFPKLASFVAMREKMSNTVNPSCGTFLEQLEGLRQQNSFEKNISFAD
                     LHFSEEDDVLSSASSVSCNSNCDMKIEVSQQGITVSNLQQGFRQQMNMNSSVVKMDGS
                     YKTQEMSNGCATDVTDNAGTIQQNKRIHSQNENPEDGQVREGGCSDVRNEPPRKSARI
                     HNMKSEGVTCGMCMTAADSTRQDASGGSSSGTKNEYYDDESELTGLSDTDSDNEVQCC
                     QEVTKVGPKTYSSENFNPEYRQAKRLLADIPYRRWIPDPVNMEDNDGPFIPIVTRPAT
                     VCMNGRRRRTFFRQCVTAFGPLSKLTYFKELLQSYVSKNNNSYLSISWPPKHGVYVMS
                     EKKLGYEHIPTLKDKFPLPCGWMMVLGVVGAEPPAALNKNMVILLCENRWVLLHNYSN
                     STHELFLAASDLKQFMEEGLSRCDPIYEESTVPYGVAMENSLRDFLRNSRTFQDLMDQ
                     RDNMHGCNWTFNGMPGRLGDRVIHLCNPESVDSIPGDEAVVCEGRPLYFFAYVTTFKS
                     NPATKATVLIAADKDLRIYGYHKGRPRIRYLCKNVKTFFKAGARKFYLDFQITPKRLL
                     AVNEEEYLNTLQNAPCLLLKPSVFRNIYSQEGK"
     CDS             complement(join(146696..147038,147149..147277,
                     147428..147437,147949..148109,148196..148309,
                     148401..148508,148605..148682,148800..149135,
                     149544..149825,149927..150336))
                     /codon_start=1
                     /gene="U100"
                     /product="glycoprotein gQ"
                     /function="cell entry"
                     /note="contains a signal peptide; complexed with envelope
                     glycoprotein H and L; binds CD46; splicing pattern
                     possibly different from that derived from cDNA with exon 8
                     more extensive at its 5'-end; gp82 /105; spliced
                     glycoprotein"
                     /db_xref="GOA:Q69572"
                     /db_xref="UniProtKB/Swiss-Prot:Q69572"
                     /protein_id="CAA58349.2"
                     /translation="MATARLSAMKPPRSCALIFLCAFSMATAPTNATAHRRAGTVKST
                     PPPEDKHSYTAKYYDKDIYFNIYEGRNSTPRRRTLSEIISKFSTSEMLSLKRVKAFVP
                     VDENPTTTLEDIADILNYAVCDDNSCGCTIETQARIMFGDIIICVPLSADNKGVRNFK
                     DRIMPKGLSQILSSSLGLHLSLLYGAFGSNYNSLAYMRRLKPLTAMTAIAFCPMTTKL
                     ELRQNYKVKETLCELIVSIEILKIRNNGGQTMKTLTSFAIVRKDNDGQDWETCTRFAP
                     VNIEDILRYKRVANDTCCRHRDVQHGRRTLESSNSWTQTQYFEPWQDIVDVYVPINDT
                     HCPNDSYVVFETLQGFEWCSRLNKNETKNYLSSVLGFRNALFETEELMETIAMRLASQ
                     ILSMVGQQGTTIRDIDPAIVSALWHSLPENLTTTNIKYDIASPTHMAPALCTIFVQTG
                     TSKQRFRNAGLLMVNNIFTVQGRYTTQNMFERKEYVYKHLGQALCQDGEILFQNEGQK
                     FCRPLTDNRTIVYTMQDQVQKPLSVTWMDFNLVISDYGRDVINNLTKSAMLARKNGPR
                     YLQMENGPRYLQMETFISDLFRHECYQDNYYVLDKKLQMFYPTTHSNELLFYPSEATL
                     PSPWQEPPFSSPWPEPTFPSRWYWLLLNYTNY"
     gene            complement(146699..150336)
                     /gene="U100"
     repeat_region   151289..159378
                     /rpt_type=DIRECT
                     /rpt_type=TERMINAL
                     /note="DRR; contains pac1 and pac2 sites; tandem telomeric
                     repeat array; direct terminal repeat with DRL; can mediate
                     DNA cleavage and packaging into preformed capsid"
     CDS             join(151789..152047,152131..153941)
                     /codon_start=1
                     /gene="DR1"
                     /product="DR1"
                     /note="DR1R; direct repeat of DR1 in DRL; contains CXC
                     motif; DR1/DR6 gene family"
                     /db_xref="UniProtKB/TrEMBL:A0A2N9DYY5"
                     /protein_id="SPC53506.1"
                     /translation="MPLTVRAGHAPYRLPLSNYWWLLLGRHSLRHVHSYLRLHKGLRI
                     PLPWPEQECLHLHPKPYKCLLRYPCITRQPHLLQGWPTKSSLWFDPKPYHPSADSKLL
                     PLGLITLSACSTRVSATTRWSSFHATDPSLSWLTGSSPWLVILQGQGGSLFCHDVLQG
                     RLYILSHSVSLFLKTGLRHCEAIYRAPLWRDRPLPSLWTCRDPDKAFLPTLLARSARR
                     GLAAFYALWRLHLGSRSELSHPVLEWESTELVLTDWRRGRNEAQRDAPSVAEHFARCR
                     PLLDELCGEGGWLPFAFLSTSPHVWLILTEGGPVLAVDVNDTSVWRIADDLELLRRLG
                     SLLLLSGLRLPLRPPSGSGEAAGEPGYEEEERRGRASTASATAATSTRGPTRPTRVTR
                     KGRVATGGVHLSARPESEEQTDGHHGRQESSDDHQRGGSGRGHRDDGAHRHANDKTEP
                     QQRGEHEERKQTDSGRHEHAQESQVARRDEEETEQGDSERSCGGATQTYGGRGRHDSC
                     PSIPLSVPGPDPRLWVPPPHLLFPSPLPPMTPVDDEPSVRPRCPPGPAEEPPTCRPRP
                     PRPSSDTPLSAVSRPSAPPVPPPSTARVRFFLSSSSSSPSYSPAPLSPPSPVSPSSPR
                     SPFIPPIRSPGLRAKPRVSSGHPAAFPPAPSSAPARSERVTSVPSSASPSASCVGKSQ
                     PPAAHTA"
     gene            151790..154029
                     /gene="DR1"
     gene            156013..157990
     CDS             join(156013..156316,157125..157990)
                     /codon_start=1
                     /gene="DR6"
                     /product="DR6"
                     /note="DR6R; direct repeat of DR6in DRL; DR1/DR6 gene
                     family; contains CXC motif"
                     /db_xref="InterPro:IPR003360"
                     /db_xref="UniProtKB/TrEMBL:A0A2N9DYZ3"
                     /protein_id="SPC53507.1"
                     /translation="MSTRHTQRTGGRISVRRNEARLAHARARARFDWLLLARGRPSKL
                     YGYASRHRGELIHLPWPPCWCLELHHDPYRDARSATVWGHRWGWPATHVRPRCVQDCA
                     LDSCLYVCCGYGEKLQPVGFVKSYVTNSQLDTLRVLLVGKDGAVYVHHMRAARLCRLA
                     SSTTEFTRRGLQRDAVTYEEDLELPDQRMCGTNARHLFDVIAAAADEHNLLTVGGLCQ
                     THAGVSCNLLETVGDPWTAVPAARMTLTVPQVQYRLWPEARRDLRRHLYAGHPLGPWL
                     VCGVLSRERETQKPSPPIRTTVGNVPTPGPREVEIAWVVLTLAGPLLAFWPDTGKICR
                     LANSFSTLWKMGPRAMRGHWTYSAPGRHLPGDAWPLCEHVRPQVGKLPRKRAYLD"
BASE COUNT        45991 a        34524 c        33118 g        45745 t
ORIGIN      
        1 cgcgttttaa aaattacgtc aaatcccccg ggggggctaa aaaaaggggg ggtaataacc
       61 ctaaccctaa ccctagggct agccctaacc ctaaccctaa ccctaggtct agccctaacc
      121 ctaaccctaa ccctaggtct agccctaacc ctaaccctag gtctagccct aaccaaaaca
      181 ttaaccctaa ccaaaacatc aaccctaact ctaacaccaa cgataacact aaccataaaa
      241 ctatccctaa cactaaacct agccctagcc aaagtactaa ccctaaccgt agccaaagta
      301 ctaaccctag ccatacccct agtcataacc ctagccataa ccgcataact ctgttcacaa
      361 ccctaacact aatcctcgca tccgcaccta acgctgcccc tctttcacac catcaccccc
      421 tgccgcttca acttcacctt cttcctccat ctcgccccgc ttgtttctac acttgtccgc
      481 ccctctattc ttactctagg atgccgctaa cggtgcgtgc cgggcacgcg ccatatcgtc
      541 ttccgctctc caattattgg tggctactct tgggtcgaca ttcccttcgt catgttcatt
      601 cctacctgcg tctgcacaag ggtctacgca ttcctttacc ttggcccgag caggaatgcc
      661 tacatttaca tcctaagcct tacaagtgtc tcctgcgtta cccctgtata acaagacaac
      721 cgcatcttct tcagggctgg cctacgaagt cttctctatg tgagtgtcat atacatttcc
      781 actttttcac atgatttatt gcgttttgtc tactacaccg ggtacatttt ggtttccctc
      841 agggttcgac cctaaaccct accatccttc ggccgacagc aagttgctac cgctgggcct
      901 aattacgctg tccgcctgtt ccacgcgcgt gtcggctacg acacgctgga gcagcttcca
      961 cgcgacagat ccgtctctca gctggctgac aggatcgtcc ccttggctcg tgatcctaca
     1021 agggcagggg gggtctctgt tctgccacga cgtgctgcaa ggccgactct atatcctgtc
     1081 gcactccgtg tcgctctttc taaagacggg cctccgccac tgcgaggcca tctatcgcgc
     1141 accgctgtgg cgcgaccgac ccctgccgag cctgtggacg tgccgggacc ccgacaaggc
     1201 cttcttgccg acattactgg cgagaagcgc ccgacgcggc ctggccgctt tctacgccct
     1261 gtggagactg catctgggat cgcgctcgga gctctcccac cccgtgttgg agtgggagag
     1321 cacagagctg gtcctgacgg actggagacg cgggcgaaat gaggcacaga gagacgcgcc
     1381 cagcgtcgcg gaacacttcg cgaggtgcag accgctgctg gacgaactgt gcggagaggg
     1441 cggatggctt cccttcgcgt ttctctccac atctccgcac gtctggctga tcctaacgga
     1501 aggaggcccc gtcctggcgg ttgacgtgaa cgacacctcc gtgtggcgca tcgcggacga
     1561 cctggagctg ctgcgtcgcc tggggagtct gctcctcctc tcaggcctcc ggcttcctct
     1621 ccgtcccccg agcgggagcg gcgaggcggc cggagagccg gggtacgagg aggaagagag
     1681 aagagggaga gcgtcgacgg cgagcgcgac ggccgcgacg tcgacgcgcg gaccgacccg
     1741 tccgacacgg gtgacgcgta aggggcgtgt ggcaaccgga ggcgtccatc tctccgcacg
     1801 ccccgaatct gaggaacaga cagacggcca ccacgggcgc caggagagca gcgacgacca
     1861 ccagcgcggc ggtagcggac gaggacaccg cgatgacggc gcgcaccgcc acgcgaatga
     1921 caaaacagag ccccagcagc gcggagagca cgaggaaagg aaacagaccg actccgggcg
     1981 ccacgagcac gcacaggaga gccaggtcgc aagaagagac gaggaggaaa cggagcaggg
     2041 cgatagcgaa aggagctgcg ggggggcgac gcagacgtac ggcggcagag gccgacatga
     2101 ttcctgcccg tcgatccccc tgtccgtccc cgggcccgat ccccgcctgt gggtccctcc
     2161 ccctcatctg ttattccctt cccctctgcc accgatgacg cccgtcgacg acgagccgtc
     2221 cgtccgccct cggtgtccgc caggtcccgc ggaggaaccc cccacgtgtc gtccccgtcc
     2281 gccccgcccg tcgtccgaca ccccgctgtc cgctgtctcg cgcccctccg ctccgcccgt
     2341 ccccccgccg tccactgcgc gtgtccgttt cttcctctct tcctcctcct cctccccgtc
     2401 ctactctccc gctccgttgt ctccgccctc tcccgtctct ccctcgtctc ccagatctcc
     2461 gttcatcccc cccatcagat ctccgggact ccgagcgaaa ccgcgggtgt cctccgggca
     2521 tcccgcggcg ttcccgccgg cgccctcgtc cgcgccggcc cgttccgaaa gagtcacgtc
     2581 cgttccctca tcggcatctc cgtccgcgtc gtgcgtcggc aagtcacagc cgcccgccgc
     2641 acacacggcg tgagacgccg cgcgaggtga cggaggcgac gaaagaggac gggaagaaca
     2701 ggcggaagaa cacgaagacg aagaggaaga agatacgaga acaaaatgag gggaacacgc
     2761 cggggaccga gcggcggatg gagcccgctc ggtctcgcac ttccgcgata cccagcgggc
     2821 tccgtcgccg cttcggaccc gaggtccgac acgcccccac ctcgcgcacc gcctccgcca
     2881 ccaccgctga caacctccgc atatcgcccc catacacacc cagcagcaga gtccggcgca
     2941 cgcacacgcg cggagcacgc acgacaacac gccagacatc gaccgccgga ggtaacggag
     3001 cccgtgcacg tcccggtttt agcgggagtg tgtgcgcgcg taccgtaaca aggaaaaccc
     3061 agcgggacga aacgatcgac ccactcctac tatccgccct ccccgagcac ggtccacacg
     3121 ccagtccgta aaatcacccg aggggcggat ccgctccgcg cccctcgccc gatccgcccc
     3181 gataaaaaca agtcatctca ctcgtgccag ttcacacgga cgcgaccgat gacaataaaa
     3241 aaaaaaaaca caccaccaca accgaacgcc cgccggccca tccaccttcc ctcccacccc
     3301 cgctcgagtc gcgcaggcgc gtcgacgggc agtccctcgg acgcctctac ggcaacgctc
     3361 ctcccctgtc ccctcggtcc aacccctccc atccccctcc ccggagcaca cacgccgact
     3421 ccgtccgcag aggcggcgac cgcagcggca gcggaaactg taacggccac gttctccgaa
     3481 cagcgacagt aacggcggcg gcggcggttg tcgccgtcac ggtagtcgtg gcggagcacc
     3541 cggggaggcg acgacaggta ccaccggcgc cgagatcatc gccgtacgaa aagagtaccg
     3601 aatgcaaaaa gttaaaggtt ttttgtaaat aaaaaaaaaa tagtacgtgg aaataaaaaa
     3661 taaaaaaaaa tatacaatat aatagtgtat tataaaataa aaacagaata aaggctaaac
     3721 accggccaaa cgctcatcct tctccgtacg tcccctttcc gtaagtgcca aatgccacat
     3781 atccatgaac ggacacacgc cggcagaatc cggccttcct gacagcaggt agcccgcgac
     3841 ctaagcacag gacggtacct gaaaccgaaa gcgtaaaggg cggtctccct tgttccgccc
     3901 atgaggcggg acttcgagac gagccaccct tcgtatacgt ccggcccctc ccacgcgcgc
     3961 ctataggacg caccccctcg ttgcgaaacc gcaacagggc acagttgccg tcacaccccc
     4021 tgtccctagc tcgcgacggg ccggcgcaga ccctgccgcg gcggcaaagc cgagacaaga
     4081 ccccgacgta cgcgggcata aagaacgaga agtcgacgcg caatcccaaa ttatcgcgag
     4141 actgtttgct cgggcccgcc ctcgtcctca tgccctctcc ccgccctcat ccccttccac
     4201 acccggtaga caaaaaaaaa caaaaaatac ataggtaaaa gtgattttcg cggttaaaca
     4261 tttttccacg tgacgtcccc ggcgattccc ggagatgcga cacgcgacac attggcccgt
     4321 tgacatcggg gtccgcagac gcggttcccc cgggggcgtc gcgacgtcgg ttccgcagaa
     4381 aacaccgcgg tccgccgtca cccttcaatc acgcggtatt tccgcgctcc tatgatatat
     4441 ctccaccgac acgggttctg tctgtcactt tttaccgagc cgctccacca tcgacagtgt
     4501 cactgactac atcgcatacg tgctgttttg cctgtttctt gtttatctcc ccacccctcc
     4561 ccgtcacaga ccagcaaaca ccttgccaca tcgacatcgc gggcggcaaa ttaaaaaaaa
     4621 aaataacata aatatagtga aagagaggcc cccgtcccac ataaggacag aagaacaggc
     4681 aaaaaaaaaa acccgtccgt tattcacaca gcattcggaa agccatgtcg acgcgacaca
     4741 cacagaggac gggcggacgc atctcggtcc ggcgcaacga ggcgagactg gcccacgcgc
     4801 gagcccgtgc ccgcttcgac tggctgctcc tggcccgcgg caggccgtcc aaactgtacg
     4861 gctatgcgag ccggcatcgc ggagaactga tccacctacc gtggccgccg tgctggtgtc
     4921 tagaactcca ccacgatccg tacagagacg ccagaagtgc caccgtgtgg ggccaccgct
     4981 ggggttggcc agcgacgcac gtgagaccca gatgcgttca agactgcggt gagtaaacgt
     5041 acgggcgagc cgcggggagg gatgtcggtc agacagtgag tgagtacaag gttcgtcgag
     5101 aaccaccaga gacaccagcc ggtagagagt ggggacaaaa aaaaaacgtc acgtcagggg
     5161 cggcgagtaa cggaaaacga gtatgaatac gaggagggga gacgaaacat agtcaagtat
     5221 gtgacgcgcc ggatcgtaag gcagtaaagc cgatgacggc ctccggcccc agagacgact
     5281 cgcggagtgg agtccagtta ttgtattttt tttgtgattt tttttatcca caatccggta
     5341 tccgtgaatc cccgcagagg tactttccat taacgatggt acaggcggta taacttccgg
     5401 aacacggtga ttacggatat cctgtctcgt ttacgcgaga cctctttgtt gtaatctcct
     5461 ataacggtaa aaaaaaacac aaaagaaaga ttacagctcc tccttttttc tgcgttatgg
     5521 catcctcgca ttagtcacca ttcctgtcgc gtgtgctttt cgctttgaat tgtacgcgac
     5581 aggatacgaa tccgttatac tccacaaggg catagcgacc acggctgtat gcggcatctc
     5641 ccgttccacg ggatgccttt gcgtgtgcag atgttctgtg ctttttttat acggtcagag
     5701 accacagaca aaaataaggc aacgcccacc ataacgttta tggtttcttg ttgttttgtt
     5761 tgggttaaac gcctcttcta tcgtgtcggc cggatccatc atgttcaatc gttgacgtac
     5821 gcgcgtccca tcacagccct agactcctgt ctgtacgtat gttgcggata cggagagaaa
     5881 cttcaacccg tgggtttcgt aaagtcgtat gtaaccaact cccagctcga cacgctccgc
     5941 gtgctcctgg tgggcaaaga cggagccgtg tacgtccacc acatgagggc ggcaagactc
     6001 tgccgactgg cgtcgagcac aacggagttt acaagacgag ggctgcaacg cgacgccgtg
     6061 acgtatgaag aagacctaga gctgccggac cagcgtatgt gcggaacgaa cgcccgacat
     6121 ctgttcgacg tgatcgccgc ggccgccgac gaacacaacc tgctgaccgt cggcggcctg
     6181 tgtcagacgc acgccggagt gtcctgcaac ttactagaga ccgtgggaga tccgtggacg
     6241 gcggttccgg ccgcgcgcat gactctgacc gtgccgcagg ttcagtaccg gttatggccc
     6301 gaagcccgga gagacctccg ccggcacctg tacgcgggcc accccctggg accgtggctc
     6361 gtgtgcggcg ttctctctcg agagagggag acgcagaagc cgtcgcctcc gatacgtacg
     6421 actgtgggaa acgtaccaac gccggggcca cgcgaggtgg agatcgcttg ggtggtcttg
     6481 actttggcgg gacctctgtt agcgttctgg cccgataccg gcaagatctg tcgtctggca
     6541 aactcgtttt ccaccttatg gaagatggga ccgcgggcca tgagaggaca ctggacgtac
     6601 tcggccccgg gtagacatct ccccggggac gcgtggccac tgtgcgaaca cgtgagaccg
     6661 caggtgggaa agcttccgag gaagagagcg tacctggatt agacgccacg gaggtgaagt
     6721 aagcatgtca cctacggcca gagacgtgac cggagaaaat catgcattgt gtggggtgtg
     6781 tatgcgtggg gtgcgtatcg gtgcgcgtac tcgttttcct tccctcttcc ctttaacccc
     6841 acgaaaaata aaatccacga acgtagacag tcacacacag ggtgcttacg ctccgtgtta
     6901 ctgatggcag gtaaccaaaa aaacgtatgt gtcggccgtg atgcaccgcc gctctatagc
     6961 gtagtcgcta tagcagcgcc cgatgccaac gcgacagggt gagtcacata gatcgggact
     7021 gcttgaaagc gcgtcgttcg cttcttatat aggcaccccg gggggtggga ggagtgaaca
     7081 tacaaaggag gtgcgtccgg gattggaggc gaacgtagaa aacgaacagc gtcagaaaaa
     7141 tataagaaaa ggcggagaca catagccttg gcgggaagac gacaacaggt ttaaaaatag
     7201 acagtgaaaa aaatagcaga ctgtgacgtc caatacacat gtggcgatca tccaatcaac
     7261 ggggtgtatc gaggcgcaga gacaaaagta tgcggaagta cacacgacac ggtaacgcgg
     7321 accgaagaca gagggcgatc gctagcatgg caagtgtaag aaaaaaaaaa ccacgttcca
     7381 aaaacaccta tacgggaaac atctcttcac tccctccccg tcccaaccac cgcaacattc
     7441 acctccgtaa tccgttgtca ccgcgtttct accacggacg cgtacacacg cagacacaca
     7501 gacacgcaca acccacccat gtggtagtcg cgggtgggta cgtagatggg gcataccggg
     7561 gtgagacgtg aagacaattc aaaacgacat cgcgcgcgac gtgccaccgt ctgggaccca
     7621 cgctggcctg gcacggtgcc aaaggaaacc accggctaac cctaacccta accctaaccc
     7681 taaccctaac cctaacccta accctaaccc taaccctaac cctaacccta accctaaccc
     7741 taaccctaac cctaacccta accctaaccc taaccctaac cctaacccta accctaaccc
     7801 taaccctaac cctaacccta accctaaccc taaccctaac cctaacccta accctaaccc
     7861 taaccctaac cctaacccta accctaaccc taaccctaac cctaacccta accctaaccc
     7921 taaccctaac cctaacccta accctaaccc taaccctaac cctaacccta accctaaccc
     7981 taaccctaac cctaacccta accctaaccc atcccccaac gcgcgcgcgc acgccgctat
     8041 gggaggcgcc gtgtttttca ccaacacgcg cgccgctgcg agacgcgtga aaaaaactcc
     8101 ccattggttg cggcccgagt cgccgcgcgc ggaagacacg cgtgtcgtgg atgcgcgagc
     8161 ccccccccgc accccccgaa agagcggacg acggtatagg ggcggacggc gcgtagttta
     8221 aaggcgaggg tgagcgcgaa gaaccgatgg cgccggcgag agaaagagag agagagacgg
     8281 gaggcagagc cgcagagggc agacgaggat acgccggagg agagagaacg gccgcggtcg
     8341 ttcccgagga gggcccgcgc gcggcgcgag agagggtgta gagcggacgc gcgtagagac
     8401 gccccgccgg gcggttgacc tttccgcaga catttttgca gacccccgac ccgtgtcact
     8461 gatgcaaaca cgcgcgcgaa cgtacacaga cacgccgacg cgcccccacc gagcagaccg
     8521 ccacgtgagc gaaaacacac acgcgcgcga aaaaaaaaac acacaaaaaa atacacacac
     8581 gcaaaaaaat acacacacgc gaaaaaaaat aatttatgta tgcattgtta tcacgatgtt
     8641 aacataaaac aacaacaata acaacaacaa taacaacaac cacagcagca gcattaacta
     8701 catcaactac attaacagac gaggacggaa tcaccggatg tcgactcctc cgtctccgtc
     8761 tcctcgcaat ccccacgaac tacggtagaa gcttcgcaag acgccacggg cattcctcgt
     8821 tctaccatgt gcggagaaag ttgatagacg gcgggcagat ctatcacagg cgcgtgaacg
     8881 caagtcacgg gcagctgcat ggtccacaga tgtcccgggg ggaatcgatg gttcttaaag
     8941 agttttctca cacccatggc gagaaacgcc ctgaaactat cggagagacg caccacggct
     9001 cccccgtcga gactggccgc gtacaccctg ccgacctgat ccatgagcac ccgttgtcgt
     9061 ctaagcagag gtgaagtgac gccccgtccg aagaatctgc cgatcaccac cgcgacgccg
     9121 ccgccgggta tgagccgcca cctcttctcc ggcctcccgg gtacggcgaa ctcaaagaaa
     9181 gccccgcgcg gccaaggcaa cggcacgaga gccttatcga aagacacggc gaaagccagg
     9241 acgtcgtcaa ctccactcat gccgccgaag aaagaggcgc cggtttcggt gagacacttg
     9301 gaaccgtaga cgggctcgaa gcgacgcagg ccgtgtttcc agagaccgaa cgcgtcctcg
     9361 gcgagacgat acagcgcgtc gtcgaacaca ccgttaaacg cgtagatctc cccgcactct
     9421 ccgaccagca ccagcgcgga aacttctgcg aagatagtga ccccgatgac cgtgagatcc
     9481 ataccgggac agcatccgta tcggcgagac agcttggcca cctcggcctg cgtgatcccg
     9541 agcatgtcgg aggtggcgaa cctcagttcg gcccccacgg gccacgagag cgccaacctg
     9601 caatgtgcaa aagtagagac gaagtcccac acgtcgtccg ccgacagcgg ccgggtgacg
     9661 agagtgcgaa cgaacgccgt ccatttaacc tccgggacct ccgcatcgca ccgcaggtca
     9721 cgtcccgcag agaaagagca cgaaggagga cacagagccg cagatgccag actccaagaa
     9781 gatatgccga gaaacggaga gccacaaaac attttatttt ctgtgcggaa tccgagataa
     9841 aattaaaaat ggaaaacaaa aataaaaaat ataacgataa cgacagcgtt accggcagtc
     9901 tcgcataaac gtctacgatc gcgttaagga tactacgact gttagggaaa aaagacagcg
     9961 ttgaactgac acattcccga cgttatccac gaatataaaa ataaaccgtc cgctcgcaaa
    10021 actgtgaaca catccccggg taaaatatac aacgatccca gacgttagaa tcacccgtaa
    10081 aaactcgatc tatcgcgttt ccattctctt tatttttttt tttttactca accacccaca
    10141 ttcgggcgaa tcatcgaacc acgtcgtgta cggcactcct agtaccagcg tccggaaatt
    10201 tattgcgctc gtcgttccta gctattaaaa acagcacatc agcgtcggct tgcctccaag
    10261 ttttctgata aaacattcgc gatagatgac aggtaggaag aagcgcccat tcgggttgct
    10321 ccctacggaa aacgtagctc ttataatact gagtgactcc tatccgtcta aactgctgaa
    10381 aatcttccgc aacgaagcgc ggccgtccgt cttcgtcgtt gtcgttaaat ccgaaaatct
    10441 ggccgtcgtc ggccacgtag agagaaatcc gaccttcgtc cccaaagtac ttgtatccga
    10501 agctgccgaa gaaacacatc tccgcgagcc tgcgccgcgc ctcgtcgcac atgacgaagg
    10561 caaaagaatc ccgccgccga tgaaagagca gagtctcgtt cttgggccac ctcagggcga
    10621 aagaacgacc tatgtgccgg tctcgaaaac acagcacgtc ccgacaactg cggacgccgt
    10681 ccacctcggg gtcctccacc acaaactgca gcgatgacac cagctgatgt gcgtaataga
    10741 acctcttcag acctttacgt agaaaatcgt caatggtgtc accgacgcgg cacagttgct
    10801 gcggcaataa ccacgtgtgc gcataaacac gaccggcgcc gccgagcaga acgactatgt
    10861 cacctttcga aaaccagtaa cacggctccg atccgattcc cccccttttc ttcacgtatc
    10921 ccagtacgac gaggcgctcc gggcaacaca ccagaccggc cagttcgtcc aacttttcat
    10981 cggcatattc attctcgtct ctacagttat tgatgaccag ctggtatcct tcaggccaag
    11041 ccaaaggaat ccgcctgccg aaatttacga acgtaaacat tcgaacgcta ttcaggcacg
    11101 tatagacgcg caggagatct acgagatctc tcttcgactc gttatagaca cgttgacgtg
    11161 tcttggtcct ctcccgagac tgcagctcag cattcccaca catcgtagaa tcttgcgctg
    11221 gctcatgaag gcctccagta aatcgcacac gccggttctt tgtcgtttcc attacgggct
    11281 cgcagtaaca gaaatagcac ccaaaactta cagactaagc aaaagttgca aaaaaatgaa
    11341 agataatata gtcacagaag aattctgtca caatgcacac ccaagaacaa cgatatggat
    11401 gatcacgaca acaataatat cgttttttct ttgtgaaaac taatcagtaa aagcgtaccg
    11461 gttttccgga ttcgtccgta tcagataaag gtcacacaag ccggcttagg aacgcggcgc
    11521 gcttcacgaa tgtctaaccc tcgttgctgc acgcgtctta taagcctacg tctgacgact
    11581 attcgcttct gacgtctccg gtgctcctgc agcctgatgt caaacgagcc gccgccgcgc
    11641 acagcgtaag gaacgacgtt cggatacacc ccactccaca tatgggtccc gtaaaggttg
    11701 cagtcgtgaa aacgaaaaaa cctaaccgga ttcgacatgt aagataactc cagagtattg
    11761 aggaagccct ccaggacgtc gtgccttatc tcgcgagcga gtcgcatgga tgcacacagg
    11821 tcgccgagac agatcttttt aaggcacaga tgctctaaga gagcacgaac gcgatgccgt
    11881 tccttgtcat aacccgatac gagaatcgcc acgatctcaa gaaagaaaaa acacaaccta
    11941 gggacgcgca tgggatcttt aatctcgaac tgagaactga caactaacag tttgatcctg
    12001 acaccgcgga ggccagaaac ggtatcgatg caacgctcca tttcggagat cgcttttacg
    12061 aagaaacgag caatggcagt gagatcactc acgatgcgct gtttgacgcg tctcagtaga
    12121 aacagacaca gaacgatgtt gcagtacacc ttcaagatgt tacgttcaaa atgccctctc
    12181 cccaactgct tatcatgaag aatgggcaaa tgccgccttt ccatagagtt aaggatgaga
    12241 gaagagccga gatctcggtc gatctccgcc cggagagcga ccgcctcacg cgcgtcgagg
    12301 tgcagctggc ctaaaatgag atcagccgga tcgaattctg aaatatcgga tatgtgcacg
    12361 gcccgggaat ctttcttacc cagatagatc cgaaagagag acgcccggca ctgatcgcaa
    12421 ctacagagca cagaagacac aaagcgataa gaagaagcgt acgcgacaaa gatgtgatcg
    12481 gacaaaaagt gtttcaagag cacactcgtc ggagacgccg cgtcgccata gatctccttg
    12541 ggattgggca aaatatcgaa cagggtcaac agagtattgg actcgctcct gttcctcaac
    12601 atgaggaact gcaggaagag ggagtccaac aactccaaaa gacggttaaa atgcgccgag
    12661 atagtatccc tcttctcccc atcgacgatg tactccagaa tcgagaagtg cgccagcgcg
    12721 gtgcacttgg tcaggagtcg ataaaaaact gacgtttcgt cctcaaaagt taaccgttct
    12781 aagagagaca taaaagccga gagatccatg gtcgtctttc cacgcctctg gaattcaaca
    12841 gaaactttct ccgccagagc cgcccagaga acactatcgt cacaaaatcg taagccgcgg
    12901 gtcataaaca gatcctctgc ggtcaacgtg ccgctatcta taatcatctc ctccgttatg
    12961 tctttcagat caacatcaag ttccctggaa tgatgaacgg taagcgagag atagggatgg
    13021 ttgggaatgg tatacgtgac ccgttctcgg acgggtccct tataaatgtc gtggtccaat
    13081 aactccatca ctcaagtaag tatatatccg agacagcgtt tattttccgt cgcggaaaaa
    13141 taaagataaa ggagcagaat tcaaattaca acagacggcc acgtacatca caatcgagaa
    13201 agcacacaat cactcatccc caccatgtcc attcagttcg ccgggacaat ccggtggcgt
    13261 gtattcataa tacttgtaat catccctgag gacgtccaac gaccccaatt tatatgcgat
    13321 agctctgacg tctttctcgg gacttatttg aaaaccgcga tgattgccac tcccaaaata
    13381 tttcaagcca ctgaaaaaaa aagccatagt cccgtttatg cacctggtgt tagttaaata
    13441 atcttcgacg acgggcaaca ctacccgttg tagccgctgt aagaaattct ctccatcggt
    13501 attaacgata aaaaaccccg gaatgagatt atcacaagac accaggtcac gatcattgtc
    13561 ctcgtgaaag cgttttatat gaagatgatg cataaaaaac atttccatga acggagtctc
    13621 atcgtaatct ttgtaggcag gaacggaaaa accgattctc agagcttccc aacactttaa
    13681 gataaactga ctcttttccc cgggacacct aacaatttct ttcatctgtt tcatcggaga
    13741 aaagtaacac aggtctccca gacacccatt ccgccctagc ttcatctctt cctccatggc
    13801 cacacacaat ttccccactt cctccgtgaa gaggtcgtaa tatatgtcca actcagcatt
    13861 tatgacacgg tagagggtgt tcacaacgaa gacaatgaag acaatattag ttaagaaggt
    13921 tagcaatgcc ttcttatccg gagtgacaga gatctggagc gaaataggca gcctactgag
    13981 ctctatctga ccttcgatca tgctcaaccc taaatccttc gctatgagac tcgacagact
    14041 cacatcgtag ggttcaccaa gatgcagaaa agccggaagg cgaattgaac ctatcatagg
    14101 aaaacactgg attcggacac tgtggccaaa atcaaacttc ctacctctct tgttatacat
    14161 gatgaacatg cgcctacact cgacacaacc acagaggagc ataaagtgtt cgataagaca
    14221 ggattcgata cgctcgaaga aatcgtacct gaagaaaaca tcggatttgt tttccaagca
    14281 gtccttcaat tcttgacccc aatgacaaag attataacct cccagttgcc gagtagattc
    14341 cttggtcaac tcttttaact tgctttcaaa ctgaaataat aacatggagg catactcact
    14401 tagataacga caccagtagc ccagcgttgg tttggacgtg aagttaaaca gagacgctcc
    14461 ggcatagaga ccgagaaaag ccagtttagt gatgcactgc cacttctcat taaaattgtc
    14521 cataaatttt aagtctttca ccatgtccgc aatctgatcg gctctgatgt aggtggaagg
    14581 atacttgtaa gtttcatact cataatccac cagtatgttc cacaccaagc agtccgaaga
    14641 gggatgtagt cctttaatgc caaatctagc tgctgcggtc ccctgcagac cgttcgtcaa
    14701 cctggcgcgg gagacgggaa caacaaacct gttggtagcg ggcagtcgac cgacgaatac
    14761 cggcgtgaga aattttgtga taaatttaac cgtcggtgaa tcctcttcat ccagacgcac
    14821 cgcaaacaga attttgctac ggtctttcac aagcctgttg taagaaaaaa aaaagttagc
    14881 ggggagtctc catcctcgaa taattatcct ctctggaaaa cgacacagaa cacatccacc
    14941 cacctgtcct ttcgcacgca catatgccga ggcttactac ggagaacggg caactcccca
    15001 ttcaacatcc tattgagatt ctccgtctca gtgtcactta tataaaataa ggtgtcgtca
    15061 ctccaatcca acgaatactt ctctttatag agcaactcat caaatcctct acgtatgaaa
    15121 gtcctcaaac ttttagagac tttgctgatt ttgttttcta cgtagatata aatgtgacag
    15181 ttcgagccca taacgatagc agctctgcaa ttcggttcag cctgagaacg ggcacacgtc
    15241 cctatgatag cataatcctt ttctgtgatt ttctctagaa tgccaggtcc agtcagataa
    15301 taaatatccg acaaggaaca aaaggaaaag tcaaagtcct ggaaagcatc caccctgatt
    15361 ctcttgccgg aatgttttgc cacgtaatcc ttcatagcag ggagattcct ctgtaaaagg
    15421 ataaattcct cccggccgca tttagtctct ccgaaccaca tcttttcctg ctctggatct
    15481 aactccgctt cggcaaaagg cggaaattgt ctaagtccaa tattgaagaa ctgaaccaat
    15541 gattctgcta tgatgtacac tttctccgtc accgtgtcca cggcaatggt ctttccggtt
    15601 gaagtatgca tcacgtatgg atcgtagtca ggatttggat cacgatatat cgggtgagca
    15661 tacccaacag cggacataaa ttcatcagca tccagcagac tgctccagtc ataagcactg
    15721 acccacctat gcgtgtgaaa gtgataaaac tcacccaggg ttaatgcata catgggaggc
    15781 caggcgatac aacatcgcaa gcccggagaa ctgatttcca acccgtctcc gtaagctgca
    15841 gacagaacgt ccacatcaaa atccaaagta ggcacacatg atgacaaggc gaactcgtcg
    15901 ttgcagaccg gtacgatctc tgtttgaaac ataaacacag aataaagtaa aatactttca
    15961 cacaagactc gctctccgcc ctccgtttca agtatcagtc aaaaatttca cacgaactac
    16021 ttactgagac tcatgcacga ttgataagtt tccgacatgc ccaacgtcga catccgtccg
    16081 aagcgcatgg agatttttcc aatcttctca taaccgtagt ccgcaaaaag tctggcaaac
    16141 cccacgcgca aaaaagtaag tagacaatcg cccagcttaa ccagcacgtt gtctatccaa
    16201 tcgtaataat atatttttcc agatttccca atacaaagaa taggtcttgt acatttagac
    16261 tcgtaatcat ggtcattcag gtaacctaac actactactt tttctactaa gtcttcctgt
    16321 tcttttagat ttgccaaacg acatgtccct gtccagacac tgtcacgagt ccctagggtc
    16381 aaactcttaa aaaccggcat atccaatcta agatctcggc cgacgttgag agacacgaaa
    16441 cgtcccacat cgtccaaact ggcacaacgg gcaagctcat caaactcccg caacatggca
    16501 atgtaatgtt tcctcatagc cttgatgccc aaaacgcctt ttctattcaa cttcacatgg
    16561 acatttagag tatagggact ccttaacaca tcattattca ttaagttttc aagcgattcg
    16621 aatctggggc cttcatacaa gccatgacgg tacacaggct ccgcgcatgt gatgatatta
    16681 gtacccagga cgccgtatct cacaaattgc tcaaaattat cacacacaaa gtggagagta
    16741 tccgtctcta aatcgtgcaa gaaaattctt ttagatcgac caatcagaat tggaacatct
    16801 ctgtaaggaa tctgaatagt ccccagtaga cacagttttt ccacaaaacc ctgatagtga
    16861 tcatccatat cttcaaacat cttttccgta tatccagcta catctttacg cggagtgaat
    16921 ctcagccagc agttccgagg ccagataata gacagacacc agttcttata cctgccgaca
    16981 aaattctcga tctgagagag atcggcagat tcgcataaac ggcacaattc ggcaagagcg
    17041 ttctcgttcg gaatattacc tgaaatctcc ttcgcctcga ggtccatctt gaaaactccg
    17101 aataacacta gaagtgaaac aatgaggtat ctgaaatata agacctggat acgagacgcc
    17161 gtcacatgac aggaaattgc aaaaaaacag agtggtgtga caaactttat taaatttcag
    17221 cctccgtttt gactcacacg ctttcctccg catgtacaaa taaatccgtt ccatcgacca
    17281 tttcttgcga atgttgaaca acaaacacct tcatttcctc ggaattatga aaatcttcct
    17341 tacatacatc agaagcgaaa gtatataaac actcgcattc cgaaagtttt atacattgcg
    17401 atttgacgta gctgcaatcc gcattcaaac ctcgcactcc gtactttaag aaggaaacct
    17461 ccatcgttcc ggcttctgta ttgcactcct cggatttcga tttagaaaac agctgtacga
    17521 ctgtcttcca taactttcta acagccatat cggcagatcc acttcagaga aaacgaactc
    17581 gaaacaccac taaaaacaga tggaaatagt cacatacaag acggtttcag cgagatctcc
    17641 gaccgtcacc tggtcatcgg gattcggacg agctatagct tcgattcaaa aacggaatca
    17701 agataatatc aggaaacccc tacgcttcta caccggtctc ctacactgcc ttataaaaca
    17761 atatgagcat tgcctcgtcc cgccaaataa atcaatacgt ttcgacaaag ggaagattga
    17821 agtcgctgcc ctaattctag atctcggaca ccaggtactt ggtcgtcaga tacacgtacg
    17881 acaacgtatc tacagctgga ctagcatcac actccctaaa ctctttaccc ccaaagaact
    17941 ttacttttta atcgcctctc cagaagaaga aaacatcgca tttaatccaa ctataacaaa
    18001 gggaggttgg atctcgggga gtttttcgta tcccgttgat tacagatcaa acttttcgct
    18061 aaccggaatg tctgcgaaca tattaatggt gccgttcgtg ccgtacaaat acccactaaa
    18121 ctatgctcgc ttcatatcat caatcgacct gatgatacta aacgaacaat ttccggaaca
    18181 cgaatgcgga gatatacaga ttttaaaaca gagaaactac ctctacctgg gagtcatcaa
    18241 aaatcttacg tggaaaaaaa gcgtcaccgg cacaggtcag acggctccac atagaatcct
    18301 aaaagcttcg ttcataggaa gttggccgga cacctcccta cctgacagag tggcactgcg
    18361 tttctttaat aacactaggt ttacaataca ctgccacgaa ttctcgatta acattgaaaa
    18421 tctcggtctc gtcaaaaaca aagaaaaagt ttttggaaca ctagccactg tatgctgcga
    18481 gcaaatccct tctttactaa caacggaaaa tctaccgaaa tatttaatag ttcagtttga
    18541 agtggtaacg caaatcgaag agcccgaacc gctgttattt tccagtaacc cgaaattata
    18601 ttttacagga gacgtactaa acgcaacgat acaactgcaa cacaacccaa attattacga
    18661 gctacttgta cacgcaccat atgacatcca tttctatcca agccgatgcc acatagtaat
    18721 tctacctatc cgatatttca caaagcccga caagcaaatc ctcatatccg gctaccagaa
    18781 cgaaggattc ttcgaaaccc aggtgatgct gtgggccccg ggaacacctt tgcacattac
    18841 gctgcgttca ttttctccaa atctgatcct gcctcaaagc acacctatcg cgaccctgtt
    18901 ttatgtagaa agaatgacaa gccagaacaa tgaacaaaaa gacgtaatcg caaagctgtc
    18961 tgagaatggg cattttattg gcaacctgaa actccccaga gaaaattttt tacatcacga
    19021 cgcgatcgct gactcgcctt tggcttctat atccaaagac tcagcgactc ccggcccaga
    19081 gacggtgttt tcatcagttt ccccgtcttg acgtatcctc agaaccatct gttcaattat
    19141 atcatctttt tcttcaggtg tctcaacctt cattaattgc gcaggaacaa aactttcatc
    19201 ctgaccgact tttaaatctg aggtttccgt ctcgcctacc ttcacttttt caagagcgag
    19261 atctatttct cgttctccgt tacccggaag cttcaagtct aacgcgtcct taaatgacgc
    19321 ggaatctaac tcgcgagaca aatcagcatc cggtagccta aacggagact gaacggaatc
    19381 gagatcgttt tgcaacctaa aatttttaaa catatcttga ggattactaa cttcaagaat
    19441 tttttctacg ttagcttcct ccgattcgcg tcccgacttg ttttctgtag ccaactttaa
    19501 ctcggtcccg cgctgattct gcaaaatgtc ttcgatgccc ttctcgccta aactaatcag
    19561 atttgtaaat tgacttagaa gattgttaac tcgctgcccg agacccgctt gaatatattg
    19621 ttcatctccg gcatttctag catctcccat taaactacgt gatggctctt gtccgtttcg
    19681 cgtcatttct ttatcgtcat taaactttcc cgacatttct tttttttttg cattgccgcc
    19741 agaatgcaag tccttgctat ttcctttccc ccctcttaat acgtcacgat catttttctt
    19801 atttaacccg gcaaaaaaat catttgcttg cttaattttt ctcaacgccg gggaattccg
    19861 agcacccaca gtttcagtcg catcgccaga atctccggtc acctcgcgtg agtgcattat
    19921 agctttatca tttctttcct tagttaagct tttcggaata tctgactgct tctgtttcct
    19981 aaaaccgtct ttgcctctca aatctttaat gagaaaaacg ttacggggtg aaacgccggt
    20041 ctccgtactg taagtcgtat gcttcgcttc tgatcccgcc acgtcggaat tattcaacac
    20101 gaagggtgtc cctgtctgct caggaacaaa gcgatgcacc ggatctaaaa agtccgcatt
    20161 cgccgctgtg tttctgctcc acggtggcga aacatttgat ttattctgat gcagattgag
    20221 attagcgaaa ccatttacca catcggtaat accgctactg ggactcccga tcgaagtttt
    20281 atcctgtagt aaatccacac cgttcgtatt caattgcgca ttaggtggaa atttaacatt
    20341 aaaatctaaa atccccgaag ggccaatttt ataattaccg tgcgacttat ctcgcagatc
    20401 cagattagta gaagtgaaag acgacaacgg cagatccaga ttggtagaag tgaaagacga
    20461 cggcgactca actccggaca ttaaagagac agaggaagca ggcgttgtcg ctttaacgtt
    20521 ttcacccccg agtgttgctt cctttagtaa aattttttcc ccggcattat caacgctatc
    20581 caactctaga aatttaggtt gtctctgcat tcttaagaaa ctatccaaac ttctggaatt
    20641 actttttttc agacgagccg gatctaaaga tgatttcttt gtatctatag acatactagg
    20701 taaagtcaaa tttgaatgta tatcgccgcg taaagggacg aaatccatta aagaattagg
    20761 cccaatctca gacatcgaaa atgctttcga cgcgctgtgt gattccagac tacttttgat
    20821 aatatcataa tcactggtga ttattttcag aaaactctct actctttgac cagtcagagg
    20881 agtctgcaaa accctatgag aatatacaat attaaaattg tcgtgcctcc tcaaatgacc
    20941 cgagagatga ttttgcgtga ttacaatttg actcatagca accttttcta gctttgacca
    21001 ggactgagtt aacgctaaaa ataacttacc gagataaatt aatttattaa tactcgttat
    21061 taagtaaccg ttttcgtccc aggggtcatt tatgttatag acggtatacc acagcatgtt
    21121 tttttcagca tcttgcaaat tattttctat ctcgctgctg tcttctgcag taagatttac
    21181 ataaggagta tcgatcgcaa cattgctacc ccacttaata aagtttccta aacgcagtaa
    21241 agcgcgatta atatcactga attgcgattc aaacttttct ttgttcgtga acatattttc
    21301 aaaaattcct ttattcagac ctttggagtt taagtactcg tttacgacac tttggagttt
    21361 cgtgatgtct tgccatatag cattataatc cggcttcctt ttagataaga cgtagtgata
    21421 cataagccat aacactagta ggttatacaa tgtttttaaa tcgtctacat cgtctccctc
    21481 tctcacgaca caagaattag tcacatgggg atgctctcgc aaatctacat tatccagtct
    21541 ttccaaattg ctgagaaaat ctgtaagacg ctcaactttg tctcgatcta gccacgcaaa
    21601 cggaatcgga tgtctttgca gatccatatt ttagaaaaca aactcaaaaa cagaactgct
    21661 catttccgcc aacattcaat gtttaatagt ctttttttta cccacacaga aaactgacaa
    21721 gcgacgagat ggacactgtc attgagctgt ccaaacttct ggtaagtctt cagacatcat
    21781 tgttaccgaa tattttaatg tagcgtaaca tgaaaataac attcaatatc tttaatagcg
    21841 caatgaagag ttcaaaggca atgcttcctg tacctcgaca cccacgctaa agacagcacg
    21901 aatcatggag agcgcagtta ccggaatcac gctcaccaca tctatcccca tgatcattat
    21961 agtggttacc accatgattc tctaccacag agtcgcaaaa cataacgcta cttcatttta
    22021 cgtcatcaca ctctttgcta gcgattttgt gctcatgtgg tgtgtctttt ttatgacagt
    22081 gaacagaaag caactgttct cattcaaccg ttttttctgt cagttagttt acttcatcta
    22141 tcatgcagtc tgttcatata gtataagcat gctagctata atcgcaacta tcaggtacaa
    22201 aaccttacac cggcgtaaaa agactgaaag taaaacatct agcacggggc gaaacatagg
    22261 aattctccta ctagcttcct caatgtgcgc gattcctacc gctctctttg tgaagactaa
    22321 cggaatgaaa aaaacgggaa aatgcgtcgt ttatatatcc tcaaagaaag cttacgaact
    22381 gtttctagcg gtgaaaattg tcttcagctt catttgggga gtccttccaa ccatggtatt
    22441 cagcttcttc tacgttatat tttgcaaagc tttgcacgac gtcaccgaga aaaaatacaa
    22501 aaagactcta ttttttatta gaatccttct cctgtcattt ttactcatac agatccccta
    22561 tatagctatc cttatatgtg aaatcgcatt tctctacatg ccgcagaaca cctgcttttg
    22621 gttagcccgt gtagagatac tgcagttaat cattcgatta atgccacagg tacattgttt
    22681 ctctaacccg ttagtctacg cattcactgg aggcgaactc agaaaccgat ttaccgcctg
    22741 ttttcaatca ttttttccca aaacattatg tagtacacag aaacgcaagg attcagacgc
    22801 atccgaacat gatcagaact caaaatcaaa agcgtcagtg gaaaaaaacc aaccccttta
    22861 aacacgtttt acaaattttt aactaataaa tgctacccac atgaaatcac gtactatctt
    22921 tttctgtgtt ttatcttcca tagagcatgg cgcacgctaa aaaacgggta cgacgaaaac
    22981 ttttaacttc gacagacgac cccatattgt ccaacacttt taccatgcgc ccgacaagta
    23041 agattgcaga cgctgaaatc atttcaagag aacatgatta tatcgcaagc aaaacacaga
    23101 cggattcaaa aaaaatatcg cccctgtctg tgattttaga caaaactgtc ctctttgaat
    23161 tttacggtat aggagacaac aacgaaaaag ctatcgtcta ccctatcgat ccagatttct
    23221 tattatgtga ctcggaacat aattgcaccc tatcaccttt cttataaaaa tttttttcat
    23281 gatctcacgt cacagttttt tttttcatat gtctcgcgtt gatacatccc gtatgaaata
    23341 tttaaggtgg ttgaaatcac accaatggtc acacacgcga tggaagaacc aaagacattc
    23401 aacattccaa ctttcgtctt agacgaaaat tgtaacttca tacccgaagt tctctcacgc
    23461 gccaacgcta aatatatcaa agatgtactc atccaagact cctacaatac ggtttgtctc
    23521 gcaaacagct ttattcccat gacgattcaa accgcagagc aaattatggt tatcatcaca
    23581 aagtttaagt tttcacgtgc acgagatctg ttcgaaaaag tactccgcct cggcgtacat
    23641 ataaacagat tttatgccgg aaaaaaacaa gtcaaacata tgattacaat gatgaaaagt
    23701 cttttcgaca ccgaagaagc catgcgacgt ctcgacagag ctcttatggg gctgtttgtc
    23761 gatgctcgtg gtagttcata tatgcctctc atagccttgt ccttgcacga aaacggcctt
    23821 ccagattcca aattcacaaa agccgtcaaa ttaataaaca caaccttaaa ctcctttcat
    23881 aatcgaccgg acgcagatat cgaacagtat gcacaaaaat tacgagcata caattacctc
    23941 tataaaatac cccattatac tttgaaagaa gctgttgacg tttattccga aaatcttaaa
    24001 gatctctcta ttggagttaa taaaaagccc acattactgt ttacttcttc agacgacggg
    24061 tatttatctc atatttttaa cgacatgcta ttcttaactt ctacttggaa tatgatttat
    24121 aactgcaaag tacaaatcag gcgtttgacc acttggatca aatacgaaat caactccata
    24181 gtcgaagatt gcgtattggt gggattccaa cttccagatc taaaggacac aatactagat
    24241 ctagcggcac tcacatcaaa tatgaatctc gtcgacccag ataaagacct tttttctcac
    24301 tacaagctca tactggaaaa actttttgaa atctctattt tcgcgactaa ggcaaatatt
    24361 tgcattttac caaccttcat aaagagtcac ctaatagagt tcgaggatgt cttaaaaaga
    24421 agcaatgatg atgaagacct caattatctg cttctgaaat ctaacgattc tgatgatgaa
    24481 tacgacgaag acaaactacc aatacaagtc gatccaggca gagtagacaa cgtgcttaca
    24541 gattctaact tttttaacgt aaccgcagat aatgctttct cgtctatagc gatcatgcca
    24601 atttcttatg ataagatcat agatgtggaa gaaaatgtaa ttcaagtcct agaagttgag
    24661 atgcagagcc tctcagcagt tgtctacgga gcagttgcaa acaaatacgg cttaagccta
    24721 ccacaagtca tcaaaaggtt aaatcaaaat gaaggacggg cctcttctcg tgcatcctcc
    24781 agccacagta cttctaccat cccatactcc cccccgcaaa gcggtcgctc cactccaact
    24841 tctatcctaa ggcaaagagc accaatacgt tccaacagca gatcatcatc ggtctctttc
    24901 tcacaagacg acgataatcg tagtcattac tctgacgaaa caaatatcag tgattattca
    24961 tatcccatgg cagatctaga tttagaagac gaagaaccca tggaggacca tccacactcc
    25021 cctcaatcag catcatctaa caactccatg tctcgtcgaa gccgagctct acaaaacgaa
    25081 caaagaagac gtacgcccac aatggcccca ccatctccgg caagaggaca aaataatgcc
    25141 cgcctcagac gcagaaccag acgctcaacg gaaacgaacg acgaaaggtt ataatcacaa
    25201 ataattttat taactgtaaa aagtgcttta tctagccaat tcattgtacg ataataaaag
    25261 ttccattgtt tgattgattt ccgtattctt gagcttgtgg atcatctcca ataaaatatc
    25321 ccgcgttagg tgtaaatcat caacgtaaga aaaaaaacga atagcattct gttcttcatc
    25381 atcaccaagt ctaaggtgac tcttctctaa aaactaaaaa aaaaaacaca aaccatcaat
    25441 tttatccatc caatccaata taactttaca ttaaacacta aattaccacc agaaaagtat
    25501 agtctagcaa cctaatggac caagcaccta attacaattt aatatatctt gaaatctact
    25561 gtacaaaatc aaactcaccg catatatcat attgaggaaa agctgttttt cttgtctact
    25621 ggttaacata tacaacaaca caattaactt cctgtaaaag aaaaacacat taatcggcat
    25681 acattagccc gctcgcttcc acgtatactt aaatcagtac ccaccttttt ataggaatat
    25741 ggttgaactg agctacgatg aaacagtcgt ttactttccg gatgttcaat ctaaaaaatt
    25801 gatcaatatc ttcccatctt tttaaaataa ataacatttc aataactagg gattttgtaa
    25861 ccgtcatact caacgtaaga gccggtaaaa tatatctata catagtagaa aagtccattt
    25921 taaatagata tttaacgtat acgatttcga tttttgaaaa catattcgac agtgacatta
    25981 atacaggcaa aggacacaat tcacggcatt cttgaagccg ttgacgcttc cacacatcca
    26041 tcttcgtcac agccaaagct ctgttccgct cagcacgata gctctccgta ttataaaaac
    26101 agatactgaa tcacacgctt taagaattaa gaatcattgg ctacttgccc atcctttaga
    26161 acatctcatt cataacacat atacaatggt acaaaacagg atttaaaaac tacaacgaca
    26221 aatattatca tcggctaaaa tttttattct gtatactaac atctccatac atcaagttaa
    26281 atacaactca aagtatgacg tatctattta ctcgtcatcc tcagatgata aatcataaat
    26341 gtaattattc gagaatgtgg gccctagaga agtatgggga cacaacggca aaatttcttg
    26401 gacggtgtta atgttcctat ggaaaaattt atagcgacga tatcccctaa caatcccttg
    26461 tcttaaaaaa gattcaaaat cgtctgctat tttaacacaa gatccaattc ccgttccgat
    26521 cgtatcaata ccataaattg cccccgataa atccatcatc acaaacatcg ttttaggata
    26581 cagtaatgtt tttccaatgc ttccgataac ctgcccgtca tacggcatac tctcgtagac
    26641 atccgaaaag aaattccatt ccatcctact aggaaaatct tctttcctag taagaaataa
    26701 aacaaatact ccatcgttat tttccaagca agacttcata atgtaatgcc tcccactatt
    26761 tttataaacg atagtagcga atttccataa attatcctgc gcatcaatca acgattgaag
    26821 aacatcatca attttcgtta gaaagcgaat gtccttttct cgatataccg gatcatagcg
    26881 acgcaatccg agaactgcaa atcgttccgt cgtttccgcc aacagataca gtgtctcatt
    26941 cacaaaatcg agaccgtaaa atttttcgtc ttctcccgca aacaccaacg ttttagttag
    27001 gcacacatca cgagtctcct ctccccagac agaaacatat ccaagtagtt gcaatctttc
    27061 cgggcagcaa agtaataacg aaccttgttt aaaaggaaaa ataactttat tttcacaaca
    27121 aaaacgagaa tgacacacca cagaactgac acgaaacact gatacttaca catttcttgc
    27181 aactctgcgg cagactttgt gggaaatgga attttacaca gtgtcgaaat caccaagcat
    27241 cgacttttcg gccaattaaa ctgtatagtt aagccggtct tctgttctac gtatgtcgat
    27301 agagaatcac gaaaaactgc aatttttata tcgtttagct tcatcagtgc aatatcataa
    27361 cgagttttaa cagaatcgct ggttcgttcg tctgccatat ctacgttatg gaaccgtcaa
    27421 ctaccccttt gaacccgaaa ctacaaataa accagctcgc atttcttatc catcttttat
    27481 accacacaga gataaaaaac tcaacttaat caactaccat ccaaaaacaa gaaatgtcat
    27541 agtgttgaac tagaactacc atctcgtcca cccatggaaa aaacaaagac aaccgaacaa
    27601 ttccctgcgt taataatgat tcttatgtat gtaaaataat acaatgtaaa caatactgat
    27661 tcaacaatat ccttagttta ttctcataga actgatttcc cgtaaaggaa acgaatgata
    27721 aaaaccaccg ttgcggaaaa ttcaaatact cgtcatatgc aaaaattccc taaaatctta
    27781 tatataagaa agccacaaac cctcaaaacc tcatacatac caaactttcc gaagatcaaa
    27841 aagagcagca aatcgctgcc accattacaa ccatgatcgc cttaaacatc aactttttct
    27901 tcatctattc caacggaagg aacaatccag agattacctc tcaagataga cagatccata
    27961 agcggcagcc atcgaatgat actgacattg aaatggtaag aaatattaaa aacgtatata
    28021 caattttacc gatagaaacg cgatatttat ttaagcactg ttaaatcatt tccataggca
    28081 gacttcttac ctgaaaacta cagtagtcgg atccgtaatt cccatcgaca aaacaaaata
    28141 gtaagtactt ttatcgtttc gttatacact aatgcccagg agagctcaga ttttgactga
    28201 tctgcacatt acgaacaccc cagggtattt acaccagttt gaaatttttt ataggtccca
    28261 ctaatccaca ttctaacgac actgggaatg aacgctatcc gcgcttctct atcaaatacg
    28321 cattgacgca ggtgagtaag tcttttcact aatccatttt aaatccgaca aaaaaacgac
    28381 aacattgact atatgtaatt aatatttttt atttcccgac aaaaaaacaa caacattgac
    28441 tataggtaat taatattttt tatttccgca gatatgattt aatccaacga ccactacaca
    28501 ttttactgtc tacgaccacc ttttccattg ttttaatgta attattttaa taaacattaa
    28561 tatcctaaat ctttcacaat atgtttccgc gtaatcattg acaaacagca tagcaataac
    28621 agcatcgtaa atgcaccccc ggccaaaaag aacaacccag cagccgacat tgaatacgta
    28681 atttcagaga aattctcgta atcgcttgaa aaatccaaaa actctttgat ctccttatat
    28741 ttataccaat tactccatgc agacctccat gtatttctta agaatttttt cggcttcgta
    28801 tcatttttga ttaatgaaaa atatttcgga tgcgcaacct ttttcttgta aatttcagac
    28861 gacaactgag gacagatctt gctcagaaaa tagatatcca aagacactct ctcatttaaa
    28921 atgttcaaag tgccattggc atcctgcccg tcacttatcc atcgactcgc attgatttca
    28981 gtgctggaat tgagaacaat ccgttccgtt ccataaaata gagtcatcac acctcctgcg
    29041 ctatgatcat ccagccagca atttacagta ctcgataaat tagcggcatt tggaagcctt
    29101 tgagcgatca aagctctaag catcactcct ctaaaataat aattaataat cacacgcaga
    29161 aaagccgttt tttcagagat agatgtaata tttccaactc tcatggcttt aaagccattt
    29221 gttaacatcg caaggttgat cagatatgaa gttttgacag aaacacagct agaattccca
    29281 gctaacactc cattcacata acaagtagag atgcatatag atctaagttt atgttcctga
    29341 attaagacta ttttttgctc gcatgtgaaa ttcgatgtaa agcagactcc cattacgaag
    29401 atataaactg acaaggactc catagttaac ttcttcataa catttagtat ttacaaatcg
    29461 tttgcaattt cttccaaaaa atctgccgcg tctctgtgga atacaacaaa acaaataaat
    29521 ttgaaaatgt agaaaacaaa cccattaaag acacggtaac gcaattcagt catctataac
    29581 ccaccttcgt gcactcttgt accagcaatt gccacatgca tcaagcgaaa acatccacca
    29641 tccctaaaat tactgtttgt gtgcacgctc tctccatccg tgaaacaatt aaaagaccta
    29701 cctcagcaca gctgccgatt cctgaacagt tttttctggg ctcttaagcc aatgaatgtt
    29761 cggtttgcat tctgatggag tagcagtgat acaataacct tttaaaggtt tttcttgcgc
    29821 caaagacgca ccgccctgaa cattttcaca acctacatca tcggttgcca tagcaccgaa
    29881 cactgtcgta tcgtacaccg aatcgattcg aggattagag acatcaaaag tattttttgc
    29941 ggtcgttttg acttccgttt ccaaaattga ctgatggacc aaatttttac cgagaaacag
    30001 agtttctgaa gaattatcca ccacgtctcc ggtttgggtg gcagcgttac acatcacctc
    30061 agaccggtct gtctgtgtat gcctcgagaa cataattttt ataccacgag tttcggtcag
    30121 tccatagatt gtgcaatgtc gagcggagtt gtcttctcga cacgataaag acatacacac
    30181 cttgccacca acatctttat tcgcagatgg ctgcagcaat tcttccgtcg gccgacaaaa
    30241 tgtatcctta acaccaaaag agtcacactg aattggtctc atggaagcac gagcatcttc
    30301 ttccacacaa gcactgctct ctaccttctg aaaccgtcta ggcaatacac ctgtcaagaa
    30361 aattggagta tgtctcattc tcgtaaaata tttttgaaat tgatcaatgt attcatcgcg
    30421 ggacttctgt gcgataaaat tactcaagat cgcgttctga cacgagaact ccatggcagt
    30481 tgtccaaaaa tctgaaaacg taggtgacaa ataaaatacc acaccatctt catatccaag
    30541 cacttgacca gttgacgata acaaaaaaac aacctgtctc tccggagccg cagacgcacc
    30601 ttcccattcc tccgttacac caaacatact catcctaccc tcaaaaggat acaacccgtt
    30661 tattaataaa cttctcagct gacggtcaga caagatatcg gaattgtcac aaatccgaac
    30721 tttaatacaa gtgatatgtt gaagaactat tccggaagcc atagcctcct gtacaacttt
    30781 ctcaaatttc agagcgagcc ccgccgaaga aatcatctta tccttaaact gcaacatgcg
    30841 cgccagttca tcaccggtga atgccattac gatgtttttc tcgttaatga ctattgtaac
    30901 cggccatcca aaaatgtaat aactgcacaa tcttagttaa atttatacga aaaaaacaca
    30961 ctgcaactcc ggaaatgggt gtggcataat tttaaaagca ccttaagaaa aaaacagaca
    31021 ctgttaaaaa aaaccaattt attaaaaaaa tctctattca aataacctca cagtcatgga
    31081 aatattttcc aaaggtaaaa tttctaactt cacattgcta aaaatttcgt gagattttag
    31141 actgtcgttc tatatcaaac gaattatttc cgcagacaac cgctatcgaa ttgtcacgga
    31201 ccttttgaac gctatggagt tccatgtaat catcagcttc gtaattgcag tattccactt
    31261 ccataatcac cataggcact tcatcatttc tcctacgcct ttttagcacc ctatttggat
    31321 tcaatgaaca tcccccagaa acaaaaaaca gaatataccg cgttaacata tatacaaaca
    31381 tacacccagc agcaattggt atcacagtaa aaatccacag cagctgcaat ttattaaatt
    31441 tttttctgtg cggtgctgga aaattatgac gtggaaacat gtcttcggat tgcttcacgg
    31501 gattcacaaa acctttaaaa ctaaaagcat cctctcttgt taagagagct ggggtaacta
    31561 ataatttatg cgtaatttca catgaaaaat tacgttgtgt catgctcaaa gctctactca
    31621 atgctctttc ataagagtat agaagttgac cggcaatttc ggttctaatg aaatcgtcag
    31681 tcatatgatc atctgaaact gtctggtttt gaatactcca ttgaatattc gttccaatgg
    31741 gccgatatcg ccgagctgta caaacgagca aacctgtatc tctcttgctg aaaacttgcg
    31801 gaggacgatg tctagagtcc ccgaaaacaa ccttaccata gaaatttaag atgtcttcta
    31861 cacaaaaacg tcttgcataa aacgacaata cgtgcaaaga ccgattttgt aaaaaactgc
    31921 tcaaatttat aagatcgtga acaaaaccac gattttcatt aaacagatct atctgtacat
    31981 aggttgtatt acccgctaaa aaaacgtagc tgccagacaa ctgcgtatta ttgttaacga
    32041 agcaaaccaa ttcgcttaca gaaaaatttc gaagagagac atactgaagc ccagcgtgca
    32101 gtctatgaaa ttcacgtatc accacatgtc ctaagaaacg gtctacggta gaattttttc
    32161 cttcttccaa gctccccgta aggtcaaaca acgtctctcc aacaaccgta tggttcagca
    32221 atgtcaaatc ttcatagagc ctctcgtaag caaaaactat atcattatca atgccaataa
    32281 cggtctgaag tttaccgatt ctttcagcca gagtagtctt gatgtaaagt ttagccggca
    32341 acgaagaaac gcattgaaat aagcatgcga caaagacagt tatcattttt aaatttttaa
    32401 ttcacgtcga agaaaggtac ggcctttgaa gaaacaatta accgccgtag tcaataacgt
    32461 atcacaaaaa ggccacatgt agtcaacact aacaaagata aagtatatta tttccttcaa
    32521 tcctacaaaa caggaaatac ccaggatacc cacagaaacc gccaccgcac ccatgaacat
    32581 aaggtttaat atgatagatg tcatctctgc aaatgataac atagccgaac cttcgtcata
    32641 aatctgaata gacttttcaa cattcttctc cggaagcgta acgataacat tatcgccact
    32701 ctccttgttc gtgcacatgc agaaatattt atcccctacc catttatcca atggaataag
    32761 tccccacgtc acatcgtcgc gaaataaaga cgtatatgca ccggacgatc tcatctttac
    32821 cgttttccat gccatatcaa acgtcagtgg cttctccgca aagatttcga tctttcccag
    32881 cctgctgaca ccccaacctg aatattcaca aactgcaaac tccccttctg cgcccagcca
    32941 cctagagaac gaacatttca aatcatcagc tctgaacaat ctttctgaag aagatctgat
    33001 aaccggcata aaatttaggt tcaacttctc gtcgtaaggc agagctattt gtctaaattc
    33061 accgtacaac tcagatagga ttttaacgtc gttgttgcac gaagatatca agtactgttg
    33121 atatgtcgag agttcattcc aaagacgtaa catcgttctg tcttcaccct gaaaattctt
    33181 atctgcaatc caagagttat tgttccgatc aagaaaaaaa gcaacacgta gtacttgttt
    33241 cttgagactt gcttcactca ttctactcag tcgtatcgat tttttattaa cagagcattg
    33301 gacttgaatg ctaataaatg tcatttttcc atgaccacat ttctgaacac gctttcttgc
    33361 aagatgcata gttgcactac tcacggtatt aaacaatagt ttatgtacgt tattaaaaac
    33421 ctgaaaacat cgaaaaacca aaaactttcc gaaatcataa tcaatttgac tgttttccat
    33481 tcctccataa aacacttggt tgttgaccgc cgcactgccc cacaactcca ctctaccgct
    33541 tctttgattt ctgtatgcag atatctctaa cagcaactcc ccagctctaa ccgcttcatc
    33601 gttccctacg ccaggggccg gacaaatggg aggatagatt tcaccccgag ctaacgtcaa
    33661 gacgcataag aaaacaaggc agatcatcat gctgggtttt ccttctcttt tgtgatcact
    33721 agcgtccact aagtccagcg aggcgatctt taatataaga tcgccgtcat accacaacgt
    33781 cgaagggtta cgcccacata ttaaacaacg gatccaaagc aaaccagcaa gaacaaagaa
    33841 ccacaacagc aaaaaggtaa accgagatac agtaataaac aaagcgctca cagcgggata
    33901 aaaagcgtcg tctctctttt cggcagaatg ctacagaaat gaagcaatca cccctctctg
    33961 tagtttttct agcgtaatcc accacatacg ttttagttct aattgactcc atcaccgatt
    34021 gatttagtaa ttgtaactgc acaccgctcg gaaaggaaac attacactta gtatcattgt
    34081 ccacgaacac aacaccaata tttttattgt atcgacataa tatcttagac cccatggcgg
    34141 tctcgataac gcatcgaggg ttaaacaaaa aggctatatc tctttcgaaa taagcattaa
    34201 taggcacact agccatccgc caccaagcag ttccgtttct ctgagccatt tttacaaaaa
    34261 tcaaccaatg ccttaactcc gtttcactgt gtgttgcgat aaaaactgaa ttttcattgt
    34321 taataatatg caaagacgct atcaccgaca cgtataatgc actcacccat actaaactac
    34381 aaccctgagg caccataatc actaataaca atctatgaga acctcatctg caagtcttta
    34441 catccctcct catttgtaca tccggttttt tctcttcatc ccaaaacaaa gacctctgct
    34501 tgtctttctt ataccaatta cacaaaatga ctatcagaat tacgaacgcc ccgataaaac
    34561 taatcccgcc gatccaaatt actaatgaac ttagaaaatc tttaaaatac tcctcatctc
    34621 cctcatgtgt atctgtaaac tcaaggactt gaacagtatc agtttcccaa agagcctgaa
    34681 ccgtcttttt cggtgtggat ttcgtcgaca aaccctgagg cgtcttttca gacacatcgg
    34741 aaaatgtcga cgccgatatt actgtgaaag acgtctcaat gttctgcgtc tcatcaccct
    34801 tgaccgtcgg aaacgaactt gtaacattta cattattgcc aatggatcga tctgtggttt
    34861 ccacggctaa cgtagaggtc accataaaag actgatttaa atatgtctca gaatctatag
    34921 atatttcggt aacattttta ccccacgttt cagaattcgc cgaaaacgtg gtttcggatt
    34981 tcccagttaa atagtcgctg gatgtcgata catccgtttc catgttttta gacgcaattg
    35041 atgcaaattc agttgccgaa acttctgtag tcattaggtt gagcattcgc acctcttcac
    35101 aaagacacac gagtaaaaaa gacaagaaca acatgttttt gcgattgccc aagtgcagcg
    35161 gttttttaat cacacccaca ccaagatagc agaataaaaa tctttagaac aatgttccga
    35221 attagttttt ataatacaac tcgacgaatt caaattaaaa atacaaatgt cgatcataaa
    35281 aaaacacgat tttgcattaa attcagattt cctcatacgt tcaaattcgc tatgttagtt
    35341 taatagtcaa tgcctgctat tccttttaac caatagagat ttttcaatgt tcatgtttcc
    35401 gctccacatc gcatcagcaa atgtttctaa aacaggtaat tcatcgcctt tgacgattca
    35461 catggaaaac gtaaagaaca aacacaataa acaaaatcat tgcgatagcc aagcccgtca
    35521 aaactaaaaa agaaaacgtc tttcgtctat tgttccacaa attccacgct gggcgagact
    35581 gcggaggcgg tatgcattca acaaacgatg tatcattgat aacgtgcgga gaaacctgtc
    35641 cacacatgac gtccatcatc agcacctctg aataggacgg cggcggcgtc cgagggggat
    35701 ccatcctctt cacgacgaag attcacgttg aaatacaagg cgaagataaa atttctccaa
    35761 acggacttaa attactaaga aaatcggagt aaacgagaaa tgcgagcacg aatgcaacta
    35821 cgagaatgta tgttccttcc cagaattcat cggcacctct aggaatgggg aatagagttt
    35881 tgcttataag caacatggta ggagaataca acctaccctc tttcaataca attaaccccc
    35941 ctgactagag acgtacatat ctttaataat cctcgctctc ggcgcgacct ctgacagtgc
    36001 tcacggagag gacagaggac gtctctagaa aacatctcat ccacctgctt aatatagtcc
    36061 gtatcttgcg taaaccattg cgtatgcaac cgacgattct cattataacg cagacatcca
    36121 atttttaaaa aatcggacat gttgcgagct atgaagagaa ggctctcctc acggtcgacg
    36181 caaaaaagca taccgtggcc gtcaaacact actacgagct ccctccagtc accgaaaaaa
    36241 ttatgctgta caataaacac tacatctagt agactcgtct gcagtttcct tcgccactga
    36301 atcaaatgtc tactagaaaa ctcagtcatg ctcagattgc aaaagcgaac aaaggtcttg
    36361 tacggatatg ttttcaaggt aaaaaaagca ttctttcttt catttcggta atgtaagagc
    36421 tcagaaaacg atttactgtg agcaatcata tccagcgcca cagtactgtc cagtgcataa
    36481 tcacacgtct cataaatcgg ataaaaaaac cgcaaaccat tagaaaacaa atcgtgaaaa
    36541 gaagaagcca cgtgataaag acttctgtca aaaaaaccat tatacacata gatgtgcccc
    36601 cgcgccccct gaaggacaat cggtcccctg caggttctcg tttttgcctt atgtataacc
    36661 ccaaccacaa ccaattcgcc tccgcaacac atataggtct tcgcccaatt ttgaacatct
    36721 tcacgtgaaa tttccgggat gttttctaca ctatgcagag tcaatcgata atcctcgggc
    36781 cagggtaaag ctaacgtggc gccctggcga ttttcgataa aatttaccag caaatcgatg
    36841 tctttgcttg aagacaaacc cataacgatg aactgcccgg ctcagggcaa ataaacacaa
    36901 attgggaaaa cattaatact gcaaaaaatt ttattggtgt tcaccaaaac aggcacgata
    36961 aattgtctaa tcacacacca aaatacatgc aacacacaac taaacaaaaa aaaccgttca
    37021 ataaatcacc cgcatagaaa gatctgtctt tcagatcgct gctcaaagtc aacataatcg
    37081 aactaaaccc gagacctaca aaggcttcaa agataattcg atataggcag acgttcatca
    37141 taagtcccga taagatcgcc accaccgcgc acgcagcggc tttgaatacg tttagtttaa
    37201 aaaatacgtt gttgaccaca gtcaggaaaa aaagatggtt agattttggc atactcaaga
    37261 acatttttcc gatccagagc atcgtaaata ataacaaaaa ttcgaccgta aactttacaa
    37321 ggcatttcaa atcaacttca cgaaacgacg ttgacttcaa aatcggacga tatttttgca
    37381 aaccaagaag gaatccagac gatcgtatca tccatccata tctcacagta atcggcagga
    37441 gagacgcagc cgttatcaag acagaataat catcgaacat ttgactctta aaaaacaaag
    37501 acaccatgat tcccgtaaac acagctgggg aataagacgg cataatcatg acacaacgac
    37561 ttaaaatcat tctcaacctc atctcggaaa atatcaagca gatcatgacc actgcagaca
    37621 ataatgatgg cagtttcggc gccattaaag acagaaacac aatcttgaaa tcacctatgg
    37681 gtttataaaa gcgtggatca aatcttttaa aagtcaacaa aaaggaaatc gcaacggtta
    37741 tcaaaacgcc gatctgtccg aggggggacc tcccctctgt cattctaaac gtatacaacc
    37801 ccggaataac ggcaccctta gcaagaccga gaataaaact atctgtcaga cgacgcatct
    37861 ctgcctcttg ggattgggat tagagctgta gtcaaaatgc atggaatcgt cactttcgct
    37921 atcttccttc tcgttaaata agctagagcc cgcagttccg tttttagcgg ggaccatgta
    37981 gttggttatt ttatattgca tttcctgttt tgatgccaac gcacttccgt cgtcgttctt
    38041 atgactccta tccccttttc cgtcatcttg tttacccatt cgttcaaagc gagattcctc
    38101 tttgagctgt tcctgagtta aaaaggcttc caccgtcaac aacgtgcttt tggaagttaa
    38161 tatcaattta cagtccttag cggctaccgt acgtaaacta cacgacgtct tgattacagc
    38221 acacatactt aaagcctgct gtaaattttt ggcagataga ttaaatcgca tgttcttaac
    38281 atcgtaaaat ataaccttat tgctgttcga aaactccagt tcattcatct ctgtcacaaa
    38341 ttttatagtc ggaggattaa cctgtactat aatgtgcgcc attaaagcgt cagatttacc
    38401 agagcgttta gtcttagtta caggtgaaag ccatttcaac acatcggaaa cggtcgaatg
    38461 atcaaggtca atcctcaacg gcgatctccc ggtgtctcgc accacttctt gtccgtgcac
    38521 acagggaacc gacgcctgtg tacatgtatc ggaagccgtt accaaaaccc tcgtatacag
    38581 atcactatca tgctgaatgt acatcttcgt aacctcagga ttcgagatga tgttcataaa
    38641 actttcaaaa agtggaatat gattattaat ggttttcgtt aaaaaacgat cagtatctga
    38701 caaaaacaaa cattccgcct gaatagtcag cttttgcacg agatgatttt tagcagactg
    38761 aattattatc gacggctgcg gcgtgaaagt cactgtagta ttctctttta acagttttgc
    38821 aaacgcttta agcgatttat taatagtttt ccagcttttc atatgaaaag ctagggtcgg
    38881 cggttctctc gtttctctat gttcccgatg atcacggtga tcacgatgat gatctcgact
    38941 accgcgctcc atctctgtca agaacgaagt cctagcacca actcgcgcct tatgtgcttt
    39001 aaaaaacaaa tgaaatgacc aacacattat atactgtatt tttttggcgc caacatttta
    39061 ttacatcact acaaaatgtt ctttacgtgc ataaccacac catccgaaca tttcccgatc
    39121 aacggtaacg gatttgataa atcaaggtgt ttatacatct cagaattaca caaaacctta
    39181 tacatagcga ctttaaatcc ggctttatac agcaacggta gcaagagtct caaactcaca
    39241 gtatcgttga aataaaacac atttgcctgc ccctgatcta aaaaaggcaa tccactctta
    39301 tacatctcaa tcaaatcatt caaatgataa ctaaaaccat ctttgaaaac ggctaaatca
    39361 tccaactcct tgtccgtaaa taggttcgtg tccacgttta ataccctata tcccacagtc
    39421 ttcaaatatt gctgatgctt gttaaatctg ttgagcaaca gattgttata cacggggata
    39481 tataacgatt ttaattccga cgaataaact gaagtgacat catttaaacc gtcttttcca
    39541 attacgactt tgatatttga ccgccttagg attttattgt cttccatcgg ccagaacgat
    39601 tcagaagagt tgatgatatc gaattctttc tgcatggcag taccggcggt gaaatgaata
    39661 ttgcgaactc cgtgcatcag cacgtctttc cttagcgttg tccacaattc ctccgggagc
    39721 gtgcattcga cattatcaaa atgatcaaag tataacatcc ccagtgcgta ttttgacctg
    39781 tcaaataaat tacatggctc tgctcctttc atgcaacaat ccacactcgt tcgaacacaa
    39841 gtataataaa tgtgttcaca tatcattcga tataatcgac gagcatctgg atgtgcatag
    39901 gataacccga cagtcatgaa aacagaatga agacccgtga cacagatacc tagacttcgt
    39961 ccatcttcga ttccctcaca cagaaaatct ttattttcta cagcataatc aatcacagca
    40021 ttagcgacca acaccatttt tcgaacaacc cgccttaatt cattaaacat aaaaaattta
    40081 cactgcaaac gcacgaaatc aatctcctca gttagctcat cgcttacttc gtcacccaag
    40141 aaatgtacca cattaagcaa cattctcata caagtgttaa taccgtctct gacgggtaaa
    40201 acatccaaaa aatcaccccc gcaatacaaa ggcacatgag gaatcataga atattgatat
    40261 acgttttttc ggaaaataag tcccatcctg ccccctttta aacaaaggca aattttttct
    40321 ataaaactag acatagtaat tttcgcatga tctgttgtcc gctcaaactc caaatatttt
    40381 gtcgagaaag ttatctcgtc acactttcct aattcaaaag ctatattttt atgaaaaaga
    40441 gaccactgcg cccttttcag ctcgtaccta tccatgaaaa tcccaggaat gatcaagcaa
    40501 aatgtgaccc gagaagtctg aggcaaagct tcatacaagt ccagccacat tagtgcagac
    40561 acatgccaga cttccacata gactgtcaac tgaaccgtct tatcggtatc acgttccacc
    40621 acccgaattt gagacagcaa tatctcaaaa atattcttgg cttcctgttg ataacgagtc
    40681 aaattcatgc ttatattaga accgtttaac aaagccggaa aaagatgttc gccgtttact
    40741 attgtaaaat ccacaaggga atataaacat gtattgtaaa tcgccacgtc aaaaaccgtg
    40801 ctattagcct tttccacgag gcccaaattt gtcatacagg aaaacggtaa aacccatttt
    40861 tgagtaaaaa gggaaaacgc cagttcttcg aacatcacgt aaggattctc ctgatatatc
    40921 tcccgcagat aaccaattct taacacgatc tctgtcaaag tagcacacat acgaagatag
    40981 atgcatggaa tactctcttc gacaccgttt aaagaattgg aaatttcttc taaaaagcga
    41041 gatgcggcca aaactccggg catatattgg tttttccaac tcacgcttac tttatagagt
    41101 acgctgcgaa taaaatctcg atacttcttt acaaagttca atacatttgg cataatcaca
    41161 ttcgggcatg ataaaattaa atcgtccgga caaaaatcgt aaaaaacact cgtcttcaga
    41221 taccatcttc ctagcattcg atccactcgt ggaacgcaat gtgtagctct caaaacagaa
    41281 attatggcat cccgcaaaca ccaagcatct aaacctgagt cgagacgatc gattatctta
    41341 gcgatgtcac gaacccgttc atacaaaaca gaagcgcatg aatattgaga ataacaaaaa
    41401 cgtttttgcg aagcttcgta atgacaaacg cattttctgt tgtagccata atctttatta
    41461 atacgacgct cttttctctt cattttcagg cagaaggctc agaagctata caaacacttt
    41521 tttctcagaa aggtcaacga atatgttctc tagctttatc actgacaggg taattccacg
    41581 atactgcaga aaacccgatt taatgtcctc cgtcgcgcaa cgaccaatac gctgaacgct
    41641 tccaaagtaa ctcagcgtgg tattgctatt aataagatag ttcaagaaca gaaaccgctc
    41701 cttttcgaaa tactgtcgca agatgtcaac tatcagatct tcgttctgaa aactagtcag
    41761 aactacgtag atcccatact ggagctttgc taaaacctcc ttgtaaacat gaaccacgta
    41821 aacatactgg gtggaatgct gccgcggttc ccagtctggt tctagtataa tctcttttaa
    41881 taccgtgagc ccgtaaatgt tttctttgtt aacgtcatag acatttcctt gcatgacgca
    41941 tgacaacaga caactgctgc cgcaagaaac taagctcgtc acaccaaaca aagacacttt
    42001 gtcttccagg tacctacacg tattgatcat cgataacacg ttatcaacca ttgagtttgt
    42061 atacatggca gttaaagcgg ttctcacaca agtagacaca ttgaatgcgt tagaacaaag
    42121 gaaaaacaga cccacaaaca gaattttagg gttgtccaca tcagtctcaa aacgatacat
    42181 caacattccc aaattttcca gctccggtgc cagtaattca caaggagtga aaacccttgc
    42241 cgctatacgt aaattctgcc tgccggacaa aaactgtttc agaaatttcc tttctttttc
    42301 tacaacatta tttaaggttc cctcatcgat agatatatat tttctcttct tcacagcttc
    42361 cacagtatcc acaatggcag ctcgtgcact cgatttagag ttcatcctta gttcactcaa
    42421 aaacagcacg tctccagaat cattactagc cgctacggca aaaatcgaac ttttatccct
    42481 ggcagccgat agcgtaacac acaacagagt aatagctttt attaatcgac taaccccgaa
    42541 aaaatatcac tttgacctca tcagacagta tgcggtattc tactttttaa actctacgac
    42601 cttaacatca gaaaataaat tgctctccgc agaactttta tacgaagaac tcagccaaat
    42661 tccctcttcg agttcgtcgg gcacagaact tgaaaactta aataatgcag aggtccttta
    42721 cgtgttcgat cgaatactca attccattaa aatgctaaaa aatgagttat cgtccccaat
    42781 cggcaagctt cgagcacaac ccgccgccaa tgacccaggt acagataaaa cgataaaata
    42841 ctccaagatt cagtcgatca tacaaaagat aaacagcttt acacacgaaa attcacttct
    42901 tgccaactgc cgcgccgtcg tagagctgat agacgatcta tatcggaaac tttactcatg
    42961 gtttctgcac gttctcactt tcgaagacat tcagtttcca ggcgacacat ttctagacag
    43021 gctgttgaaa atggactact gttttacata ttacccttct tcaaatcgcc atctaataga
    43081 tctgttcgaa aagacgttgg acaatcaaac gttcacgaat ctcgataaat tttttgacac
    43141 ctcaggaaac agcccagaac tactttatca aaaaacgttt agcttgaaaa tattttcaaa
    43201 aaatctcaca gcccaggaca atggattata tatctatcca ctacttaaaa ccgacctgtc
    43261 catcctcgac ttcctcggaa ccgaaaatat tctcttccat cgaggcctca tctatcacat
    43321 acttcatcaa aaaacaatcc ctcaagaacg ggagaatgat ctcaataaaa tcaatcaatt
    43381 tttcgctact gtcatccagc aggttatcga aacgaaaagc tcatgcttac ccgcatcgtt
    43441 atcccaactg ctagatacaa tttttcactt caacagaatc ggtttaaaca tggaaacgtg
    43501 cagaacctac atcgagatcc tctcaaacca catggcaacg ccagacaccc aacccataat
    43561 caatacattc accattaact taacccatat tgttttcacc gcgcacgtgt tttttatctg
    43621 tatggaaaat tttagcccaa cattcatatt ctataatagg aaaaaactca tactagaaca
    43681 acagagagcc attttgatca tcgaacgaaa tgattattcc acactctgga agcaaatatc
    43741 tgatcacatc gaatgtctct ttaacgtctc tctctccgaa tcctttttta aagaatatac
    43801 caaaggagga aacgaagatc aaaaacagtt tctatacaaa aacctattcg aaaaatgggg
    43861 taacgtattt ttccctttca cgtactcggt atccacctca aacaactcta cggcacacca
    43921 tattacaacc cttgagctaa gagacatctg caaagaggtc tatcagagcg attccccgga
    43981 cgcatatgaa tctttacttc cctacagcac tcatccatct ttcaaaacat tattcgttaa
    44041 aatctacgtt atacctatgg tttcacacat taccaatctt acctttgata aattacaatc
    44101 tgattgcaga ctcttaactc taatccacgc ctgcaaactc ctactcccct cgcaacatct
    44161 actactacac tacatggcgt ggctatatgc cttctccata aacgtggacc atatagatct
    44221 aggcactttc accgtaataa agtccgtaat ctttaaaatc gctgaccaca taaacgtgat
    44281 gacgcatacg atctactccc cggagacaaa ccttctcgta agcattctac taaacgcgta
    44341 taccaactac ctccaaaaat acgtaaaccc ttggatcaaa caaaccataa cggcaaactt
    44401 ctccctgata cagacgtaca taactttcac gaaacaatgc gccagcatct tggcgaccaa
    44461 atgcaacata aacttagaca atctatttat ctacataact atcggaacag acaaaattgt
    44521 caccacttcg ttttgctcct tcatcgctac atgcaggaat ttagtacgtc aacacgaaga
    44581 attcgaaaaa tcactacaaa cgatccaaat ttccgaaatc acactcacgg ggatgctacg
    44641 aaacataatc acgagcgtct cctcctccaa agagctgcta accaacgaag cactacaaaa
    44701 attcatcgac actgtccaac gcatctccca acacgtaaac gaaacatacc attctatttc
    44761 cgtgaacctc gaaaaatgta aaacctcaaa cgacatccta atcgaatccc tgaagaagat
    44821 catctacata gttgatgtac tcagctccaa tgcaatccta aacacgtcgt tagcttccag
    44881 atgtctggaa gccgccaacc tcgcggtttc gaacaattct ttcacaatac tcgaaattaa
    44941 aaaggacgca gttgccgttt tcaagccttt tataacacaa ctatttgaaa gcatgaaacc
    45001 caccacaagt ttacataaga aattgatgtc tacccaaaaa ctaaccaccg accacattcc
    45061 atttctcgat acatttgacg ataggtacaa cctggtcaga cacgtcgaac gacaattaaa
    45121 ctggtacgct gcacatgctg aggcagcaca gcaagatctt attactcctc ttaaatttta
    45181 acggtcgcgt tctaacccat gaaaatcatt accagtagca caaaccaaaa tgactctaaa
    45241 tacggaccga gagccggaaa acaatgcatg tcgaacagct tttcatttct ccataccgtt
    45301 tacttaaacg gaattaacaa ttctctcaat gcgggtacta tagacgccat aatggaagaa
    45361 ggctatcact tagacacggc cggcacctta gccctaatgt taaataactc agattcgcaa
    45421 gactacagac tccccaccga gatccccaag aggatccatt ctagatacgg tgtcacacag
    45481 catgaactct cacggccatt taacggaacc ctagacacac aaaaaattga caatgaggta
    45541 tatctcggac tcatagattt catactgtat ggcaaaagca agaatggtcc tacttttgca
    45601 gtcatcacga tcggcgtgct atcgcgagca cttttttttc ttaacaatac tctctactta
    45661 ttcgactctc accctactga acgagaagcc acagcagcca tctacatctg tcaaaacatt
    45721 gaagaagttt atgaactgct caccacccac ggcaccgaag gcttctacta cgacgccagc
    45781 ctcatttttt tcatagaaac ctccaatttg tcgctctcta gtcacgacgc cgagcttctc
    45841 atcctaaaaa cttataaaga ccccgacata gcgattgcgc tagataaatt ttcttccacg
    45901 gaaatccatg agataaaaaa aacagatgat atcggatcgc aacaggacct cgttgcggat
    45961 aaaacgacag atctagaaca cgcgccccat aaaagaaaga aaaactctca tagtctagaa
    46021 ctagaactaa atgacaaaaa gaaaaaagat accgcatcct tgacatatta cgcaacagaa
    46081 gttgacctca ttccgagttt ttatgaacta cgatcacaat ttcaatcttt atttcacgat
    46141 ctcaaatctt ttcctataat gaaatctaat ttcaactgga ccatatactt acaagattct
    46201 cctattaatc ctaatcagcc cttcgcaaca ccctttctct ggaacagagt tttccactta
    46261 ttgtgtcaaa ttatcgacgt gtttgtaggc gtcggatcca caaatgacga ttctagcaaa
    46321 caacaacaac aaactatttt cataaattat ttattgcctt tcaaggactt ttccgaagta
    46381 ttcaacgagg cgttggcagc ttgtcaagaa aacaatctgg acatcatctt catttacaat
    46441 aattacctgt gcaaaaccac gacctttcga acactcgaga gaatcttact aagtaaattt
    46501 ctggcaatag ttgataatga tcacaaaaaa cattatgaat gggtcaaatc gtggaccacg
    46561 caaatgttcc aaggaatgcc aaaaaaacta gatgacatag aaaattatct aaaagcctac
    46621 gtggaccata accctgtgaa acactttcat gaattcattt gtctgaataa ggcagaaaaa
    46681 tacaaagtag ctgttctgct aaacgaaaaa cgaaaagaga ttcaagaggc tattgaacga
    46741 gaaaagaaca gtttcgcaca actctctaat tttattgaca aacttggcga aactcccgca
    46801 cttcctatag aatcagaaaa cgtgcacaaa gttcacacga gcgacatcac tgaaggcatc
    46861 gttccgcgtt tcataaccga atcgattgaa ctaccaaaca tctccacgct aaacaacacc
    46921 caacaaatat ccctagataa acaactcaat gaaaaactca ccaacaccat tcacacgctc
    46981 acaaacaaat tcaccaaaat cgtacaagat aactataaca atatcgctgc cggtttcatg
    47041 cccgttaccg aactgaattg cctatttgcc tacctagtaa acctttattt taacattgaa
    47101 gttttaaaac acagtggcct aaacattaac actgtgttgc ttcaagaggt ggaaaaactg
    47161 tatgacaaca cgcaatttct acgcttcgga acttctcact tcaatataaa caacctttca
    47221 aactttaccc tatctatcag aaaaatgttc gtagatttct ataacagcca gaaaccctcg
    47281 gacagagctt ccgaaatcct agccgcaatc gaatccatcc tagcggatcc cagcaaaaac
    47341 aagacagtcg taaatataga aatgatcaaa tcgcaacttg aagaactggg gaaaatggaa
    47401 atctccacca ccgaaaacaa acagacagct gcaatcacaa aacaaatcct aggggaccaa
    47461 gagttaaccc ccatttacga tttcctgcac cacctctctg cttataacct acctaatact
    47521 acaaccgtaa aaaatttaca cctccatttc atcttagaac aacgaccaga tatcgctatg
    47581 actctacacg ataaaataca atccatactt gacatatatg tagacgacat gctcaatgac
    47641 ataacggtcc ctgaacagac gttttcaacc gttctatttc ttgtagatct cttcccaaac
    47701 agcaccgaaa aaacagcact gttcgaatcc gttctcacgc tacggcaatt agcaaagaaa
    47761 tgcgctaact taaaaactct agatgaattc gacgatctgg cccaattcat cacgacgaat
    47821 agcgaacaac ttcaaaacat gatgagacag cattttggaa aaaaaatacc aacgctgatg
    47881 ggacatatca aatttctcta ctctcaaaaa ataatcacca ctgaagagaa aaactggata
    47941 cagagagcaa aaacggtcgt catcacatct cccgaagaac tgacagcctt cttagccact
    48001 gcacccacta aacacgcctt acaaacttgc aaacctgacc tcgataaagc actacaacga
    48061 catatggaag agcaaatgaa acaaactgcc gagaacgaca aaaaacacat actcacaatc
    48121 agaagcaccc tcgaaaaaag actgaccgac atcttactta ttctaaagga tggtcaattt
    48181 tcgtctctgg aaacaatgca tttgaatctt ttagaaacct ttctgaaaca actgcaagat
    48241 aacaatgtca tcattcactt tacccatgca ctactgccag tgttaaaaga catagaaacg
    48301 accatcagca agatcatctc cgacgttatt gaaaagatat taatcaaaac tcctctaaac
    48361 cccgaacaga tgtccaagga agaacaaaaa tatacccctt tactcagttt cttatccaag
    48421 ttcaaaaaaa caacattctg cacagaagat gtaaaaacag aaatcgaaca agtacaaaag
    48481 agtatcacgt tcctcaagaa aattgctacc tccaccaata aacatactag actcagccac
    48541 tccatctacg gacaagaatt aaacctctac gaagagcgca ttacagagct gagaaaagag
    48601 acgaacaaaa tgaaagaaca gctctccaaa gaatacgcat tagctgaaaa aaaaattctt
    48661 ctctcgtcac aagatgcaaa aactgacaaa atttatctag ttctaaatac gcacacgctg
    48721 aaagaaataa aaaacactca attcaaagaa acagcattcg ctaaagctct cacggtggaa
    48781 gtcaacaata aagaaaatca actccaggaa ttgttaaacc actttaacgc acacctaaag
    48841 gcgaaaatgg atcagaacca tataacaaaa ctttcattcg atacgaaatg gacagccttc
    48901 gtttcagatt ccaggctcta catcccagac ttcattaaca tcaaactgca agactttatt
    48961 tctgatccct ttaaagttat aagtcagcta atgaacaaag caaccaacga gatgccttac
    49021 attcaagcag agataactct caaatggtta acaaaattaa tacacgacat caacaaattc
    49081 tgcctgtcag ctataagcga attcggtaaa gaagcaatcc catttaatta cgcagcccta
    49141 cgagatttgg agtaccagat caacaccaaa tacgtagaaa ttgaaaacaa agtcatttgc
    49201 aacgaaacgg tcgaaaacac gaaaaacatt ccaaaactga ctaagctctt gaagcagtta
    49261 gatcctaaac gcgttgccgg tgggcaggaa cagtatcaaa ctctcatgaa caagattctc
    49321 acttccgaaa cttctatgca acagacctac gaaaaagaac aactcaaaaa agaatacttt
    49381 gagatcgtca ataatgtcgc cagcttcaag ttagcattca actttcctca gcaactacaa
    49441 aatgtggaac ggctaataga gaagttcaaa tcgctgccca aaagccagcc atttgaaaaa
    49501 tttccacagg aaaatgatct actttctgac tcactcaaca cagaaaatta tattaacggt
    49561 ctgcgcgcac tcctcaactt cataacggca gcgcaaaact acatccagaa cacacttctg
    49621 aaacagtggg cggtctttca gcaacaaaat ttcatcccga ttgattactc agtagcgaat
    49681 gtcaaaccta tttcggattt atatgcccgc ctcaggattg aacgggaacg tcaagtgttc
    49741 taccaagtaa actccgtctt tggaactcac ctaatcgttg acgatacagg agttccgctg
    49801 caattccata acatctttaa caacgccata gtaaagtttt tctccctgaa ctacaagcag
    49861 attaatgtac cagaagacac cccccgcttg gtatctagcc aatataaact cctgtccgta
    49921 tgtaaatctt tcataatgat actacaacag ttctgggaga atataatcac cctggaccta
    49981 ggcccttacc tcagagacgg tacacaaaat tttaaaagag aactcatacc gatcgtgaac
    50041 ttgaaattat ttatatactg cataacacaa gcctggacag cctctgaaga cagtactgtt
    50101 tccacagcgt tcgaattacc catcaagcaa ttcacacttt tgatactatg ctcacatcct
    50161 gaatacctct acggctgcct cagtcattcc acagatctgg ttataaattc attagccaaa
    50221 agcatagaca aaaacagtct ctataacaca ttcgtcgtta gccacaaccc tcccgagaag
    50281 cccatgcatt taatgagaaa tatatgtatc gacacccagc tatggcaacc cgccaaactt
    50341 atgaaagata ccttccaaca aacatttttt acacaactgt gccccaaaaa cgaaaagttt
    50401 tttatctatc tcactgcctt tttaattcta ccctacaaat ttatgaacta tatctggatt
    50461 caatacaaac cggccatttt tacccaaaga tcttatcaaa acctaattaa ggacttatgc
    50521 tccgaatacg tacaccaaaa taagatcact acgtcctcgg taactcccca cgaaccagac
    50581 acaataaaat ccggagaaag gattacctca aaaatcaccg tacacaaagc acaaaacaca
    50641 ccgacactca ctcgcctgca ggctcaggaa tatgtcttcg actacattct ttactccttc
    50701 ttgacagggt atgaaatgac attcgccatg tacatcgata tcatcgaaaa aacatacctg
    50761 ctttgcatga gacacctgga aaacgtactc cacgataaag acttccaatc tgtcctcaga
    50821 gcacgcacat tcgacatcga ctacatcctg aaacagtcat ggactaaaaa catagtcgaa
    50881 cattcactct tttcagtaca gctcgataaa atcgtctcct acctcaacca cacaaacaga
    50941 gcgacaccca atattccttt gatattattt aattatgaca acgaagttgt caacgtttat
    51001 ctaccgccga tgtccaccaa tccaaaaaaa gtcgcctttt acatcaaaaa tcctttccac
    51061 tttcccgtgc aagaatacga agcgacaaat ttaatttcct tccatctcta cccaaaaaca
    51121 acagatattt taaaccaact tccgcccaac aatactgagt ctactcgccc gggtaaacaa
    51181 acctctgaaa ctttaaccaa caaaaacctc tccgaaccaa agtttaaaaa gcctgccgtt
    51241 actggactta tgcccaagag ccaatcgatc atcctatcca ctgataccaa cgtaccggaa
    51301 accagtccag acgtaaaagc taacacggcc agcgcagcaa taaaagatgt cactctagct
    51361 cgagaaaaaa tcaacgagtt ctccgaatcg ataaatacaa ctatttcaaa attaaaatct
    51421 atgtatctgt aacattcaac acacagtcat actcctttta taaatgttta ttatccaaac
    51481 atacgaaata aatgaagctt tcatcaatca ctccctgttt ttgtgttcag tctatgcagc
    51541 gccagcattc ttatcaaatc gagtcggaac gccgttttat ccacgttacc gccgttctgc
    51601 ttagcatatt ttggcaaaaa aaccccaaga acgggatgac tggccatatt aggctgcagc
    51661 cccaaaacac cggtaagcat ctgctgcttt ttcttttctt cttctttttt tgaagaacct
    51721 gaaatctgag tgatctgatt cgacaaatca tcactacgta tggtcgtcat ttcaaataca
    51781 cctcacgttt tgggaaatct ggcaaccttg acagatatta acacagtctt ccagatctaa
    51841 gcaagtctct ctaaacgaat gctgacagcg ctgacactga aaatcagaac cgtgtgaaac
    51901 aagccgtaac aacttcttga cggtcacgtt gtagagatgc acagtagaat aacaggatct
    51961 acacgaacaa ggaacaataa catcgaactt cacattgtca tttaaaatag tgcaagcaga
    52021 atttgttccg atcaccgcct tccatgaaac ggttttcacc ttcatcccca atacacaatg
    52081 ctcagacatc tcatatatcc gctcgaacac caactgctga ctcccacaca gcgaacaata
    52141 cattacatcc gtgtgcatgc tgtatatcaa atttttctcc tgcttgtctc taaaatagaa
    52201 catggagctc agcgaaaagc cctgcggcga acacagcttt tcttttccgg agtttaagca
    52261 gtgaccacat tttgcgcaaa taacgcaaat gtaactctct tcgagtataa agcgagaaca
    52321 tttagtctta caatagcaca taacgggtaa cgaaataaca ctggtagcta agccatcctt
    52381 taaggacgtc gccaacgcaa aggttagaat ctttggaaaa tcaccccgtt caggtttgct
    52441 cggcaccata ggtactagat tattatgctc cactggaata agatatctgt ctgcactaaa
    52501 acagaagttt tccaccaaag cctttgccat agtaaacatg aaattccccg ccggagattt
    52561 caaagcatac tttcgcaaca tagagggaaa tgacaaaacg tgctctctct gcctatatcg
    52621 caacatcacc gtctcggtct gctcatagtc acgtaaacag aatagcctca tacacggtaa
    52681 gttcacgtgc gtcggaatcg gaagcaacaa ctgttgctcg aacaggaaca tgtgcaactc
    52741 attgatttcg gaaaacgagg gcatctccaa caacttatta agcttgtacg ggggataaac
    52801 cctgaatcta gtctcgacgt ccacccattt gattgtttta agtttataaa gagacaacaa
    52861 ttcgagaact ttacactgcc gatacacgaa atacagatag gcgagcaaaa caaaaagacc
    52921 ctttgtcata accattttgt taaaaagtcg cttagtgatt aatcgcgtct ccggcctgca
    52981 acgcaaccaa attgcgaaaa actcattata aaatttttcc gttacttcct tattcaagaa
    53041 ttttttattt gtcaaaaaca ttgtaagaac acactttcct ggcacacagg cctcacccat
    53101 cacaaacaat tgcaaatgcg tgtacgaccc atgtttacac aacggagcca gaagctggcg
    53161 taggagtttt tttaagtaga acataacaaa aatacaaggc taaaagaaaa cagatgccga
    53221 caagcgcaaa ccgacaatgt ctttcactta gtctccaaaa cttcacaccg gacagtaatg
    53281 acttctcttt ttcatagaac tgctttatac tctcctgtga tgtcacaacc gcagaagctt
    53341 tatttacaac tttcccgcta ctttcgaatc gccccttttc caaaacatgt gaagaccttc
    53401 ttctcaaacc ttgacaaaac ctatttgatt cgagatgctg tttccccata gaacacttct
    53461 ttaagaaaat tgccttcaaa agcgaaatgt attcagattc gttttcaggt ccgaacgcca
    53521 caaactcaac aacgtaagtg tcgtctcgat tacgcctgat tatacatttc gtgaacactg
    53581 caaaagttga aggcttcata gccactatgt cgctcatgcg gacagtcaaa cattcattaa
    53641 cacgcaggat gttgcattct ctcacagcat gatgaccttc tactttaacc ggggcatgca
    53701 aatagcaaga catcgacaca gctccacctg tgttcttgaa cacaaatctg ggttcctgct
    53761 tagttacatg ttcccaaaga cttagcagat attctagatt ataagcgtag tctaacttga
    53821 gaatgatatc acacaaagga aacttcgggt tcttcgacaa tagattccgc tcagttatcc
    53881 tatagtcatg agaccccaac tttaagatac gacaggtcgc actcagtagt tcatcgtaca
    53941 tcttttcttt gagtacgtta gccatttcac ctatttaaaa gctattccgt atttaaatat
    54001 tcttgatgtt ctaatattcc atttacattt aacagctttg acaatatcga agtaagaagt
    54061 accatttttt gagccatgac ctctctatgc acgcaatcga catccccgtg aacgtatcta
    54121 gcaaaagcaa cgtgtctata tccaacacta agaaaattca gtcgcgcctc caaagaagga
    54181 agcatcattt catataatcg tggcaacatt ggataaaaca cgacctcaaa ctcccttccc
    54241 tgctcacaga ctcgctcata caaaagttca agattcgtct tttcaggtga ggaatccatc
    54301 atgtacaaag gatgggactc agaagcgttg cctatacaat ctgagatact aaacgagatt
    54361 ctgttatatt gctacctcac tcctcaacca ccgatccctt ccgagacgac aacagccacc
    54421 agccccacaa acatagaaaa cgaaatatcc aatttagaca actctgaaaa cctagaggaa
    54481 ttaaagcaac tatccgtcgc attaaatata gacagacgat gcaacatctg ctccattgta
    54541 aatctgtgcc tcaaacaaaa caaatcatgg atctacgact acagtctact gtgctacaaa
    54601 tgcaactacg cgccaaaaac tccactgtct cttctgatcg tttccacaga atttttaatg
    54661 ttaatacggg aacgatttcc aaacatcaat ttcgacggtc tttttctaaa caacattgtc
    54721 tccatctttg actttcacgt tcattttttt attcacagat gcttcgcaaa tacagtcaac
    54781 gatcacatcc aaagcgaaaa cataaccctg aatcacatgg caataatccg atcgaccctg
    54841 ctaaaagaag acactatacc gcacatcaaa ataaaaaaat ttctaaccaa aaaaatgaac
    54901 ccgaaaaaaa cacaaagctc cgaactgaat aaaaaactca cagtgcccat gaagactcgc
    54961 ttcacgacac tcttattcta tatgtggtct ggcacgaacg tcttcgaccg agttcccttc
    55021 acggacctaa ctatccgcaa acatcgcttc atcaaaaacc tgtattccaa taaaaccgac
    55081 atcgaactca cagctggtcc cattcttttg gcacagattc cattttctat caccaaaaac
    55141 aaaacaacca gcgtctgtct cctatgtgaa ctgatggcag cttccaaaca agattaccta
    55201 tttttaaaat atctacatca gagcatcatg gactactgtc aaaacaacct aaagatgata
    55261 gatagagttc agttcgtcat cgccgatatc ttcgagaaga caaaaataca cacgcacgtc
    55321 aaaaatcttt ccgactacag caaggcgata ttcgataacg aattctcatt ctcagatgat
    55381 aacttcactc tcgataccca cgtttacctg atactccgcc agactggaac agtgggagtc
    55441 tataagcact tcttttgtga tcccctgtgt ctagcaaact gtaaaaccat caacccggag
    55501 gttctcttca acactacaga cgccggagaa atccaagact tgaaagtcac catatgctac
    55561 cgtaacgaat atttaagcat cgtcgaaaaa catgtttggc tagcgataca tcttttcaaa
    55621 gcttttcaga ttattaaacc aaaccataaa aataaaactc aaattacaga gtttctcaaa
    55681 gacttcacta acctattagc acttcaccac ttcgatatcg tcgatcccat tttcaccgtc
    55741 aactactacg tttgaagaat gactgtacac aagagccgta ttcgacgatc gcgaagcctg
    55801 tccgtgacac acagaataca aaaacgacct gatcacagag aaaaaacaaa gctttactta
    55861 caactgaaac ttcacgatct acacaccgtc ttcaacctgt ttccagaata cgaacagaaa
    55921 tttctagcga tcataaaact gccaattacc ggtaaagaac ccatcgacgt cccattcagt
    55981 ctcagcaatc accaccaaca cacctgccta gaattctccc cctacgctaa cgaacaaatc
    56041 tccaaaagcg cctgcctaca ctgcgaatcc gtctccgttc caacctcctc agatgcaatg
    56101 gtcgcccact tgaaccaagt caacaacgtc atgcaaaaca gactttactt ctacggtttt
    56161 cgaaaggaca tggagctcat acgaatgtcc gccaaacaac ccactatctt tcaaatcttt
    56221 tatattgtcc acaacacgat caacaacata ttccctatca tgttcgaaag aaaacaaaag
    56281 ctcggaatgc acatagtttt ccagtctcgc actctgcaca ttccttgtga atgcattaaa
    56341 caaatagtag cggtatcctc gggctacaac gtttatctag atatactaca agaaagtgta
    56401 atcctaactg tcctctgcga aacactagat accaatacta atatccacat cgacataggg
    56461 atgcttcaaa aaaaactcga agaaatggac atcccaaacg aaataagcga cagactcgaa
    56521 aaatacaaag gacacctaat aggtttccat taaaccactt tattgttaac atgtacaaac
    56581 gacaaaacct aaatacattc acattacctc tgcaatagca gaaaatgttt catccaaata
    56641 cactttcata ggaagtaaat acaatagtaa cttctctttt tttatatcgg ttttcggaaa
    56701 aatgggtgag atcgcattag tcacagcctt gataatctga tcgaaatact tctccgcatg
    56761 tataggaatc ttgtgttcta tcacatagtt gggatcttct gctaattcat agttatgcgt
    56821 ctgtttattg ccaatagatg gtgctattaa cacgtacata attcggtcac ctacattcgg
    56881 aatttcttcc tttctctgcg ccaaccttct aatgacgcta aggtgagcca gattcggttg
    56941 cttatatgca gccatttctt tggaaagcac agaggacaac attaaatgtc tcacgtctgc
    57001 ccgattctga aaaagctcct cccgcgcttc gcacagacga cgcaaaattt tatgaatacc
    57061 cacaggcact ccttgttcac gcaactgtgt ctgtgtcatg tgagaaaact ccacagcagc
    57121 agtctgaacc tcttcatcaa agaacaacaa gtccacgata tctttcacca cacccttcac
    57181 aaaatcgcaa gaagtctttc tcaccagatc taccccctta aaaattaaaa gcgaatcatc
    57241 ctgtctacca atgtatcttt ttttacaaat caaaattagc ggacataaaa tcttttcaaa
    57301 ctcgagcttg ataggcgact tgaacagacg atctgtgata tgtttggcga tcatcggcgc
    57361 aatccttcgc agagactgat taaccatatt tctgacagac ataaagatgc tatccgtatc
    57421 accataaatt acctccactt ccaaatcacc agtaaaatct gatgacgtta aaccaaattc
    57481 ctcgcaaaaa aattgctcgg actgcatctt ggaattaaca taatccaccg tggaacaaag
    57541 catctctctt ccaagacacg ttacagaagc agcaatcgca acacacggca ataacccgtg
    57601 cgccgctccc gtgacaccgt acaccgagtt acatgttgtt ttcagagcga gctgcttttt
    57661 atccagaaga agtttcatca tcggatccga acagttctgc atctccgcct tcacttctcg
    57721 tctcttggcc agccagtcct ttagtagact cccaagcaca gactcacgga tacaaggctt
    57781 cacaaaccga tgagtctcat cccccaactt cacggttaag atgtcactct ctgacaatcc
    57841 agctatctgt cgttcatcca aaactaaagt actataacac agattatgcg ccatcataat
    57901 gctcggatac aaactttgaa aatcaaacac cacggtaggc acagcataat aacccgtctt
    57961 aggctccaaa acggtagccc ctttgtaacc tatcccttgt ctattgtgcg aagacaccat
    58021 actcggaaga atcatattac ggcgttttgc ttccgtaaga atgcagggaa atatcttctt
    58081 ctgctgaccc tcgaacacca cacatctagc cgtgacgtgt gccaatctgg cgacctcggc
    58141 aacctcaaaa tgataattaa tctgtttaaa gagacgcaca actaagacag agtcctgtag
    58201 acaatactta ccgacaacag ccctgccact gggtccacta ataaatttct ttggtatttc
    58261 cttgtacgat aactgctcct tttcttgctg gagacagatc ttagcaatag tatccagttt
    58321 gtaattctgc gccgttatct tactagaata gacgggatac atatccagat acaacactcc
    58381 ggaagtaaac accttggttt gcgcctgaag gaaccccttc ctgtactgtt cgtgagggac
    58441 agagattcca atctttccat tcttcagttt cgaaaaacaa ccaatatcat aatggtaaat
    58501 cttatccatc cttatacaca aatattttaa atcaaaatta ttaatattat aaccggtaat
    58561 aaactccgga gactcaatcc ttaaaaatat gaaaaaaccc aaaagtaatt caaactctga
    58621 cgcaaattca tatatatgca cgccgtcaat tttttcacat gttcccagag taaacagatg
    58681 tcgctcatca cggtcacctt ccgtatcgaa actaattaca gaaatctgaa taactatatc
    58741 acctaaattt tcggcatccg ggaaattccc attttgaccc aaacactcta tgtcgaaaga
    58801 ccagcatcca tataaaggcc aattaacgtc ttccagagaa actaaatcag agacatgaca
    58861 attaatttcc acctcaagat tactcccttt tcccatatct tgaggaatat atttttttac
    58921 attataccat ccgaaactca aaaaaccatt atcgacgaag aaacgagtca aaacatctac
    58981 gtcgatttca taaactacga atccctcatt ctgcagaatc tttccaatac gttgagatac
    59041 ataaaaattt ccaaaactca ctttaaacag attaacgaca gtgttggcat tgtacccata
    59101 caacgacaac ttatcagccg gctcaatgac aaaagaacac gacattttaa cctcgccggt
    59161 taacatcaaa ttgtttatag tagccttcag gcttcttccg tcgacgcatt cgcagtagaa
    59221 atattgctcc tgtccaaaca cgttcacgca gatcttctca ccgtcctcag ttctcccaaa
    59281 cattctaatc actgtccccg aaggaatcac aaaatgtcta tactgaaaag gaagattctc
    59341 gatcgaatcc gtaaacatta acgtttctac agcatcatat atgtgaaact tcatcctcat
    59401 atgatcataa tccttggacc gagctatgtc caaactcggc caggtcattt ctttgctcag
    59461 taaatactgt cggtctcgat aaaacatacg cggttcagag tcacaaacat cctttattaa
    59521 tcccgccgca ccatcatgca ttataccgcg aggaagtata cgaatgtaac tcgatctgct
    59581 ttttttcttt aagcgattcg cttccaaata tggattaaaa aacgacaccg aatccatcac
    59641 gcttcttcta catttacact cttataacct ctatacctga tcctgtctat caaactaggt
    59701 tttgaggcat gagactcaga agacgaaggt tttcttctgt aggactcgtc taaggacttt
    59761 atggccttga gcatttttaa agcatcttct tgtgaatatt catcgtcact tacttgccca
    59821 ctgacgtcag ccataccctc ctccttttcc gaaaccgcaa cagatgtgcc cccgtcaaca
    59881 tccttaacac taggtgtctt gacgacagtg gtccccgtaa cactggacac agtagtcacc
    59941 ggattggtgg cataaggaaa catcatgtca ataggcttac taagcacatg tctttgtcta
    60001 acgaaaacca caattattat cacaacaact actatcgcta aaatcaacat gagaccaccc
    60061 ccgaatggat tttttagaaa agacaccact ccacccacaa tatccccaag cgctcctgcc
    60121 gtaacactta taaccgagcc caatccagtg cctatagccc caagcccttg taaaaaagaa
    60181 ttaatcccat taacatacga aggtgtattc gtagcaattt tagcttctat agtatatagt
    60241 gcgctcttat atgagttata ttcacgaaga atattctcta gatcgaaaac gtttgctcta
    60301 ctcaattcgt ccggcgaata taaatcgagt actttaaaat cggcattttc aagaggatcg
    60361 atttttagtc taataaaagc atccaatacc tcaatgtctt ctatgggcgt cgaattcgta
    60421 tgcgtataat cggtatacac gtgcgcatga tttccagata aaaagatctt tgtactaggt
    60481 atttcacatt cctctgtcct atgatcaccc aacagaattt cattatctaa ccctagctgg
    60541 ccagggacaa cctcaggcgt cgagttcaca aaactaaacg tcaccaaggg ccgattataa
    60601 cacatcgttt cactccttac tccctttgca tcgacgaccc gcatactctt atgaagctga
    60661 acggatgact gattaacctc tatgcatttc gagatagcta acacgtcacc atgcaactgt
    60721 gcagatatcg gacgaccgta aacctcagac acgatactcg acggactaat cttactaagt
    60781 tcgtgcaaca tcgttatcgt tcgcttttga tcgagacacc aagattctgc caaattcccc
    60841 aatgcatcat tgatataatc tttcaaagta tcataaagat actgtaattg cacataaaga
    60901 atatcatgtc tagacttaac atcccccaca tctcgcctcc tacgtatttt ttccgaaccc
    60961 tgctcaagaa acataagaga tttttgcaca agaggttgcc aaatcaaaat caaatctccc
    61021 gtagtcttaa aaatttgata actaccattc atgctatatg tatcattata atctgacata
    61081 tagacttcat taattatttt ttcaaattca ttcttaatac acgtttgttt cggatcggta
    61141 agatttaagg actccttggg ggcgacgaaa gcggctgtca actccttaga gataaagtga
    61201 taggtctcat tcgtctccgc tcgaagcccg tgagtcaccg tggtccagtg ctttagcata
    61261 cacaccgatt cattctcttc cttgatttcc caagaaaaca aagtatccgc tttctcgaga
    61321 aaagcgattt tcctcactaa cgtagtggcc ccattcatac cattcattag atcttctatc
    61381 atagtatagt tttccaagat tgtcaatttt tctaacggct ctgcaaaatg tttaccgttt
    61441 gaaccgttga agaacggaga cccttccacg atttcgccag tcgtcaaagc aaagtaacta
    61501 aacgggtatt tcgccttagc cgtagcctcc gtcacaatac aattgagaga cgttgatgta
    61561 gaatatagcc acaaaggacc ccttgcaaag tagggttctt tcgtagtgat aaatctttta
    61621 ttagttatag atttgaaatt cagaggaaat aaatttagag tattgttttt attattatcc
    61681 tcatgaaagg cactaaacac cgtaccatcg ggtcgtttca tcgctacggc ggaataacac
    61741 tgcgcatgag aattaactaa atttgcttcg tacaccggca tggccaaacc catcaccgtc
    61801 cgatccagaa aataaaccac acccacatca cggtaactac tttggaacgt caactctttt
    61861 ttatacgttc tcactggaaa agtgtaggtc tcgatatttg ttttgtaaat gatgaaaaaa
    61921 ccctccgaca tctttgcatt agacttatac ggcgagcacg aaatatctct gtcgaaccgc
    61981 attaaatccg tgcctttggc aatcgaacaa atccgaaaag gatatttgtg attatagccc
    62041 gctctgatat aatgatccgg atcacaatat atcattaaaa cactattcat caaaaagaca
    62101 gccaggaata atactgccat cttgctcatt ttccctaacg agatctagta gattaggcgt
    62161 tcgaacagag taacttactc cttccggcac gtctacagtc tctctcgaca actgagcttg
    62221 caaatcacaa tataacagcg aatacacgtc tttaaacttt gtcatgccac caccagtgtg
    62281 aaataataaa ggagactcgt gattaaatgt caaaacgaca tttccactca aatccccctc
    62341 ctcatctata cgcacaattt ttaatcgctt tccaaaaaca tcattatata gtgcaacaga
    62401 aagtgttaac tctctgataa aattccacat ttttttctgc atgtcattta catcagttac
    62461 accggaaaag ttaaaaaatt cattgtattc gcacaccatc cacacactag gatgaatagt
    62521 gccctctatg catctagcta aatcttcctt catatgcggt aacatctccg cgtggtcgca
    62581 accatacgcc attgagatgt tcgccggaag tggataggca gatttatgaa aatccgataa
    62641 cggacccgtt aacaatgtgt acataatctc acttaaatcc ggcaagagct ccaaagggag
    62701 cttcttcggc atcagattgt ttttaatata aagatgttca tcgtatgtac agctatctac
    62761 acggaaagag ccatccaagt acatttttct gagaacgaaa ccgttcataa tcttcgataa
    62821 ggcctcaaaa ataaaattcc catacacatt cacactcact accttattta tgagtgattc
    62881 ttgctctcga atacatgcca tcaccctatt ataaccagat tcagaaacct tttgaaaata
    62941 cgcctttttc cgggccaaga cttcctgctg aagattatga gtttgaagca tgcaattgat
    63001 cgtgttaagc cttcccggtg tttctgtcgt ctgtggatcc cgaatgtcat gcaagagact
    63061 cttaatttta tgttgaacct catcttcctc agccaatctt ttaaatattg gactttcttc
    63121 gagattttta atgctcaggc cagtgacaag atctatcagc ctcgaaggag acacataaat
    63181 ggagccaacg tacaagcgct cgtcatgcgt taacaaattt tcactcaaag ccaagaagtc
    63241 ttcagacact tcaccgtaaa gataaagact gacatcattc tgtaattgct tatacaacgt
    63301 atgacaacta tttaactgct gaagcgtaat agcgacattt ctcactatcg tttccgatat
    63361 tttagaccaa tacgtaaact cacttaaaga atatatcacg tcaggtacct tgctaaaaat
    63421 attatacttt ttcagagttt tctcagcatc actaacatgc aacgactcgg ctgaacgctg
    63481 ctgcttaaaa atctttttga tttcagtcgc aacagactga acagtcccat agttcaaaat
    63541 agcctcccct aagtctttct ctatcgtctc aatgtttttt tcaatattaa aaaaagcttt
    63601 ttgttcggtc aaatgattac aaaacttccc atgtaatctt cttcgaagtg attttccttg
    63661 gtttggagtc aaagtcaatt cttcgtaaca cttcatgcaa gtcttagttt cgagataact
    63721 ctccggtttc gcaaccatac atgcaccaca catgatagtt aacaagtcta taatttttcc
    63781 gcaaatctgc aacccttctt ggggcaaaag taaagcatat acggagttga tcttactgat
    63841 taattgttct atatcattta gcgtagataa ttgcacgata aactcaacac cgttattcaa
    63901 tgaaatgttt attgacaagt gctcagcaca acgcctcaaa cacaacacct tttcaaaata
    63961 tttttttcta tcctggtcta ccataaagct ttccaacgct gcatccaaaa gaagcacctg
    64021 ttcatacata gcttttagca gtacctgcat ataaaccgtc aaagctgacg cacaaagaag
    64081 attttgttct ttgatacctt caaaaaaagt ttgatataaa tgcagaatca caatcccatt
    64141 ctttttaaaa tttgccatat cagacaatac tattacagga tcacaaaact ttaaacattc
    64201 aaggtccaaa gcacattcat taagcctagc gcacaacaca cacagagatt gtaacgaatt
    64261 catactccga ttataatcgg tttttcttag tcatcggctc atctgtttcg gtttccgttt
    64321 catcacattt taatacaccg tttccttgat cgtcctcctc cgctagaatt tcagaaaagt
    64381 catagaccgg agcatcgttt gaagacaccg tctcgaatac cgactgcaga ttagttattg
    64441 aaaagtcttt cacattcata tcaactaagt gattcaattt aagcattatg gatgccgcta
    64501 aggcttccct accatccaca aaaaaaagca tatcatccat agtcggcttg tcttccctat
    64561 ccctcatcac ctcagctatt attaataatt ctggatcaat atcgttagtt aaattctcaa
    64621 caatgctgag aaccttgccc ttaactactt ccgtatcaaa cataattgcc tcacgccgaa
    64681 cctttttcac tataacttct gaaaactttg tagcaataat cgttttctgt ctcataaatc
    64741 taaaatcctg caatgcagaa gaggtagggt ttaagttcct atccacgcca cttccgccta
    64801 tccaacctaa ctggccaaac tgaaaatatt ccctattagc caaactcaca aatttctcta
    64861 atgtcaaacc aaatgtaacc aaagatcgac ttgtgaaaat tgtaccaaaa ttgggttctt
    64921 tggacagtga cgcaatcaca ggattcggaa cgccatccaa aactaacttt ttaacataaa
    64981 ctaaatattc ctgaatagaa gaaaatttag gctgcttgtc taacaccaca ggaaacaaca
    65041 caggattctg cgtaaccagc ttagatgtaa gaccatgtaa actagtcaag tagtcatgaa
    65101 aacctaaagc cgacaaaaat ttgttatgaa aataacaatc tataaaagtt gagagacact
    65161 ctggctgtat gtcgataata tctatctcat cataggtatt cgtaatactg aatgcaaatt
    65221 taataaaagt tttaacttct tcggggttac caatatctaa agttttcgga acattgttga
    65281 gcagaaaacg ttgccatagc tctaagcacg aaatcttcac attcggaaac aatttatcat
    65341 gatatttaaa taaaagaaag gagatacagc cagacaaggg attcttctta tgtttcacgt
    65401 tttttttaaa ataaggattg ttgtgtgctg tcttactaga cttgttgaac ggtctatttt
    65461 ttattctaaa atctcgaaga cattgcatag acaaacggca aagtttcgcc tgaatcgtag
    65521 ttttcacata tttacccgat ttatatagat cgcaatctaa gatttgctcc atatcaacat
    65581 ttgaagcgac tttaactgtt ctcgtattca gaaaaccctt tttgagatag ctgctgtgaa
    65641 acgttccgta taatgactgg tactgctgaa cgagccattt agaaattgaa ttaccggtac
    65701 aaggtctatc gacaacatga cctgaagcca ctatcaatgc gaggttctgc aaaaccgtca
    65761 aaatgacctt ataatatgaa aacgtcaaaa aaggagaaaa ggcagttgca taaggggtcg
    65821 tatctacatt aaatgactgt agacaatttt ctatctgttc tctaggcgtt tgtgtccttc
    65881 tcatttcaac aatgcatcta gaaacacatt cctcgataca ctgtgttaat ccgtgaatta
    65941 tagaaacaaa atctttttta cttcgaacat tgaaagtatc ttcgcctgtt acaggatcaa
    66001 tcagagaatt ttttttacag taatcgaaga tctgagatac gaatttaccc ctgtccagtg
    66061 agagcgtgtt ttgttgatct tttccaatct ctttgagctc gctgacaggc ttcctgccaa
    66121 aagagcctaa tatatcaacc tcggcataat accgagaaaa catgctcata acaagtggtt
    66181 cctttttaac attctttggt attgccggta aacgagtacc gacccgcacc atggcagttc
    66241 caatacacga ttgacaacat ttcccatcac agaattcaca taaattcgcc gaacaattta
    66301 ccagatgatt gtaaatctca gtatgcgcat tacccgcgtt ataaacgctc atacgattta
    66361 aattccacac cacaaaagaa agcagctgtg gagaagtcgc acaggcataa gccaagtgat
    66421 tagctgaaaa tttgtcatct ttgcctgatg tcgaatcaca tttgataatt tttctattat
    66481 cgttatacac atcgtcactc aaagacgaca acgcattaca aaaagacaaa gatctcagca
    66541 gtaattcctg agtcatcacc gaattaaacg cttgtttcac gtttggtata aatgccaatt
    66601 ttgagcaata taagatagaa tttggggcaa agatcaaaac agcaagatga ctagacagat
    66661 gtaactttaa attcgtgagc tgcgccatgc gttcagcgtg tgtctctgag tttcttatga
    66721 ttggccagtc attaaaattc attatctgac tagggtcata taccgaatcc agatattcgg
    66781 ctacatgact aaacgataat tctgtcacaa cggaatcaac caacatcaaa aaatctttct
    66841 cgaccgctga aattttctgt ccggagatac ccagataagt tttatggggt gctaatttga
    66901 cagtttgctc cccatcctgt gtaaattgtt tcaggccagc atcgattaat tccttagtat
    66961 tagaaaatcg taatgttgta ccccatgatg taaaaacata ataaaaaagc gtttcactta
    67021 acgcaggcag aaaaaatcct cgttcctgaa taaattctgt acaggaagat aaagaaatcg
    67081 tttcttcagt ttcaaataaa gttgcggaat atagaggaat tttcacacac gaatactccc
    67141 caacttgtac ttgaatttgt tcttcaacac aaggaattaa cagaccagcg aacaacaact
    67201 ctttgaaacc gtttccacac gcaacatgac aaataacaga atctgcatct ttgccgacag
    67261 cagaacaaag agctttgata tcgattactt tgcgtgctgt aggcacctca aacgattgca
    67321 agtgaaattt ttgtctggtt tgctcacata atcgaataag atcaccatga tcttcggcca
    67381 taccaactaa ctgctcagtt ccatgaaaaa aaaaacacac gggcataaaa gacgtaattt
    67441 tagttagaat tgtgcctcca aaattagtga taggtgtttt aaccgtggtc gagaaatcgt
    67501 tttctacggt caaattcatt aacaacggcg aaataactat aggagaattt ctctccatta
    67561 acgataaaac agataaaaca tccaaaagtt ctttatcttt tgggaaaaca tagatccaag
    67621 cagcagtaga aacgggagca gaaactaccg tttcgttttc atcagccatc tttgtggatt
    67681 tgatcacaga aacagagata atggggtttt gtggtgaaat ccttatatat tatgtttgac
    67741 gtaacataac acgcgtcatc aaacataaga gtaaaccaca agttgaatta taccgttttc
    67801 tatatgaggt ttacggtcaa aagaaaaacg atttttttat gcaaatattt tccacgcaga
    67861 tgatatgaca cgccccttaa tttaaattta tgcaaatcgt cgtccacctc aggtacaata
    67921 gtatattata tatatattat tttaataaac ttattgagga cgggagaacg agggcgtggc
    67981 gtttacgtca tagcctaatt atgcattctc agaacaggat ttaagaaggc tgcgagcggc
    68041 cgactgttca gagggacgct ggggtacggc ttgatacgtt tgattgaaaa tgattcttcg
    68101 tgtgctattt tctgcaaaaa aattaattcg ccggcgacag taaacttttc agcggaattt
    68161 caaaaattaa ttccatatgt aatttaagca ttttaaaacg tataactcac aacgtgaaaa
    68221 catatttacg aatacagtag ttttcgtgat atttttcgaa attaaaaaat tttaaatcgg
    68281 gtaaatgata aagcatatta ttagattctt cacgttaaca aagcaagttt ttttgaggtt
    68341 ttcggtataa ttttaacatt tacttccaca tgtaatttaa gcattttaaa acgtataact
    68401 cacaacgtga aaacatttac gaatacagta gttttagtga tgttttttcg aaattcaaaa
    68461 agtttaaatc gggtaaatga taaagcatat tattagatta cacatgtaat ttaagcattt
    68521 taaaacgtag aattcacaaa gtgacaaaac attaaataca gtagttttca cggtattttt
    68581 tgaaattaaa ttttaaatcg ggtacatgat aaagcatgct gttaaattca cgtttttagg
    68641 gcaagttctg cgaggtttgc tttgtgatta tcagtgaatg tattcagcgt ttcaatttta
    68701 gattatggtt cggtaaaaat ataggtcttt gtaaaatcat ttgatttagc ttttatatgt
    68761 attagattgt gaggtgtttg aagtcgaagt cgttaatatc gtatttagaa ttaaggaatt
    68821 ggtatttagg atactttttc cgtattttta gtcgcgatga ggttatgacg atggtttcgt
    68881 ttgcatagtt taaacggtaa attcaaaatc cgaaaaaagt tcaaagagtt tcatggatag
    68941 actaaaacag gctttcaagt tttagctagt atttattttg aatttcactt agggtacata
    69001 aagctttggc atcaaaattt ttttgatttt agaaagaagt agttaagagt gtgacggcaa
    69061 aaagtttgta caaaatgtaa gaatttgttt acggtaagat agttattctg agtcagaaga
    69121 acatgcgttt aagttagttt cacaggtgtc agcttcatag tctaaatcta agtccatttc
    69181 aacactcgat tcactttcat gtttagagtt gacgttttca ttaatgttaa taatcacaat
    69241 ttcttcttgt tttgcttgat tgaagtttag ttctctagga tttggtattt tgttgtcggt
    69301 ttccattgat tcttctatga gaatttcggt agttgttttt gtcgttgtta ggattgaagt
    69361 gtccggtttt tcgacacaaa ctttggactt gactttaggc gtaccgtggt ttttatgtga
    69421 acgatgagag gtctgaggta ggtcgtgatt tgttgaatag ctacatgaag gttccgtgtc
    69481 gacctttgga caagtaaaag aaagatttcg gtattcttca ggaaaatttg gaaatagctt
    69541 aaactttggt gcgtctttgg cgaaataagt gcaaaaaaat agactcggtt tccaaggagc
    69601 catgattcgt tcgattctat tctgacagct gacatcatcg catttatggt tactgaattg
    69661 ttttccgatg agtctgctca tcagaccgca ttcgtatcgc tcggctaccc gtcctgtgtc
    69721 gaaatcgcgg atgaattgcg gcttctttgt ttgtatgatt tgctctttga tttgtcgtag
    69781 tattcgagca aacgtaacaa cgatggacat ggcttgttga attgggtgtc taaacgagtc
    69841 tggagtttgt tgttgtactt caagctcgga gtttggcatc tctcgatcta gtacaggttt
    69901 accgcagagt tgcctgagtt ttcggtattc gatgtcaccg tgtccgttgt cgttaaaaac
    69961 acaggttaac tttgccatgt tgagtttgtt gaaaaattcg aatttcatga cggtgatggt
    70021 atacatgaat aagtcttgtg ggttgaccgg caggttgtga agatcgtgaa atttaaaata
    70081 actgcaggct tcttctactg tagcaactgt aaaagcaaga caaggtgagt tggtcaggga
    70141 gaatatccgg tcgcccatca gttgctgatt ttcttctcgt gtgagcgagt ctagacattg
    70201 tcggtagcga agcagcaggt cggtttccag tatatcatta gtcaggagac aaattcgttc
    70261 gtgagtctgt gggaatctgt ctcggatgcg ttgttttgga tcacgggcgt ctccgttgta
    70321 aggtctcagg ccgagagatt ttagcgaaaa gtttgtgtcg gcaaagggga ctgttggaag
    70381 attaggcaga aaggtgatcg cattgttttg agcgcgtttt tcttgttgtt tctcttcgat
    70441 gatggtcttc agctgttcta actctgtcag acttagtgcg tctagtctgg attcatccag
    70501 ttgtttcaga ggtgcgagtt ttcctcgaaa atttttggcg aaatggctga tgaacttgct
    70561 ggtttgtcta tgcgtggaac gttttatcgt tctaaaggcg gtttgtctat gataatcatg
    70621 atgtgagcgt tttactccac gaggatacat gtttgcttat aatagatgaa atgacataaa
    70681 ttggtctctt tatatgtttt ttgagatgct tttcgttggc gcttttttgc ggttaagttt
    70741 tgcgaaaaaa ggaaggacgg tgttactgat gttttaatct ccggaaatgc taggatatgg
    70801 cgcgatttag ttagcgtgtg cgttggagtc aaatggtaaa gactaaaaga aggtctgggt
    70861 ttagaggtag taagttagtt tttcaattgc tccaaggcga tggaacaatg tacttgtttg
    70921 ctgttggact ggcatttagt agcaaagcac gtgctccaca agatgagaat taaccgattt
    70981 ccgtcggctt tgagttgtat gtaaactagg acgttatctc gatttcctct atgttgtctg
    71041 ttcaggcagc taaaatccga aactcttcca aattgtgttt ttttgatctg gaggttcttt
    71101 gaatctattt taataaaagt tacttgtgaa aactgttgcg ctatcctagt ctcgtaatga
    71161 gtaattagtt gcgttttaat gattggccat cctattaatc tgataaacga taaaagggag
    71221 tcatccgctg atgttgcatt gttgttaaaa ccatgcgtgt ttaggtactt ggtgattaga
    71281 gtctctgtag ctatgttaac tttgttccac agttgtctgg attttaaatc catgaaactt
    71341 aggttttctt tagggcagcc tttatccgtt atgttataga ttaattcttc gatgggagcc
    71401 ttcttagtac cgtgatgtag aaggttgttt aaatccattt gcatctgaat aaatgtcttg
    71461 caagaatttc ggtaaccttc tgggacgata aatatgggag ttagacgtcc atgtagcatt
    71521 ttccctttgt ccatgtctgt cttgtacata taacctattc tgatgcagtg acctgtgtgg
    71581 taaatgccga tgtcgaaaca ttccccggga aatgttatgg aattgaggat ctgactaagc
    71641 tcctgatcta agcacataac gtgatttaaa atcttggata attgttttaa tggttctcca
    71701 ccggcaatcg ctgtgccatt aggtaatggg attgatattc taagaccgat ctttttccga
    71761 caaacacaga attgtttgat ttcggttgga tcttcagtat agtctagtgt gtcgttagtt
    71821 gtgtcgcact gggttttgaa gaagaagatg ggatgtgtgt ctgtgtcgat gcttggaaaa
    71881 atttttttcc aggcgttgat gagggtaagt cttatgaggc gacacatcga gaaaaatgtt
    71941 tcctccgtaa tagttgctgt atcttgcagc ggaagatcca agtctcctat gtaatttgtg
    72001 actggtatgc gttcgttgaa tatttcgtgt cgtgtggtat agaattgttt ttcgacgtcg
    72061 tcgcagagaa aatgtgtgtc ttgcagccag atggcgcgag ttagagcttc atcagagata
    72121 tattcgtcgg ggagatactg taagatgcgg ttaaatccca tgttttcgta ccaatcctca
    72181 gagtttccga agcaaaaaat atttttatgt aaaagctgca ccctgaatac aggaaaggga
    72241 cggtgataat ctttgtgtag gtgttgtctt ctgtagatgc gcttatcttg tatctgaacg
    72301 tatctatcgg aagcggagat ttctaataat ccttgtaatc ctggttttac tggagaaaaa
    72361 agaccttctc cgtttttatt acatttcgct atggcacgcg ttatttgttc ggaagttaat
    72421 gcttggatgg tcttcttttt agagaccaga gcatactcgt attctgtaac gtttagattt
    72481 ggatttttta atctttttat gtctatgtat gttttaaagt aacaatccgc attaaagtat
    72541 tgcttcatga tacacagtaa attttcgtgc agggaatttc caagaatgtg gagatttctc
    72601 tgacattgtt gccctattgg taaattagag tcgtaagaag tgagattgca gtaattgacg
    72661 aattttgttg tctctagggc cgtgttgtaa gcgatatata tgtaatggac acggaatgtg
    72721 ttggttagat gtgaactctt tctaaataga ttgatttgag tgtctagatg tttaaattct
    72781 tccttatcgc gaagattttt ttgtctggcg tacgttgaga agtctgcaaa tagttttcta
    72841 aattttgatt ttaaagtgat gtttataaat tcggacatgg aagaatacgt gaacaccatg
    72901 tttccggtgt tttccgtgaa gcattgaaca taatttttgg tagtcgtgat ggtactcttt
    72961 tgttcctcga acaaatagta aaacattgtt aataaaagca taccttctgt ttgcccgtag
    73021 gtcgataaaa accaaaaggg ggaagtgggc aataggaatt taccggtgag atatttgata
    73081 atgagcgatt tgtggaaata ggccatgtat ttaaattcga cgtcctctct ttcttttcca
    73141 gtttgagata atatcatgtc gacatataac gattcggttt ctttgtcgtt gaggctgttg
    73201 gcgacatctt cagcctttat cggacttgca gtttgtatgt agtggctgag atttaatttt
    73261 tcggcatggc agacaaatac cgtgtcgatt cgctttgaat ttttgcattt ttgagtttga
    73321 aggcagaaac taacgttatt tgatggttta tatttaacaa taatcggaaa gattaaatgt
    73381 tcactgggac ttctacatag gatactaaaa attacgttgg cggcatcgta ttcagtcgca
    73441 aacactacga tggtcattgt gtagagctct gttgattaca gatgaattta gctttaaatg
    73501 tccttggggt attggggtgt tatgggaaat tgttttcgac gattatcttt gtttggacag
    73561 ccgactcagg caaagtatga aatgttgtgc tcttccgacg atttagagac cgaagagctg
    73621 acgttttttc tggatatgac gtataaagat tttggagttt atcagaatga tattataagt
    73681 catcaaaaag acacggaaac tatgaaaact ctgttaggct tattaccaat gtacaaaaaa
    73741 actaagctca ggcatacggt tatggagcgt tgtttatcta attgtcctaa ccatgttaaa
    73801 gatgcgctct gtgtagagct tatgaaagct gaaaaaatat tacaaacgat ggatgtcgtt
    73861 tttatgaaaa ctttaattgg cgaattttcc atgtgcaccg aaaatcttaa tcagttgctt
    73921 aacaaattcg ctacagatca gtcaacactt agcgatgtcg agaaaataaa cagtctcata
    73981 gagattgatg gtgaaaacag caaacgtctt ttagtcgagt tggatccgat tctccatgag
    74041 gagacgggat tatatcaagc gctgccaaat gttgtgacgg aagctccaag tgaaaaggtt
    74101 aaatcgatac gcgttgagtc tgaaggtgag agtgtatagt taagcgttat tggaggcggc
    74161 ataatgaaac aagaaagagg aattggcgtc tagtacctgt agccggttta ttgcacgttc
    74221 aggcattaaa ctgaggcaaa aatgtccgca agtaaaaatt atcctggcga tgcagatgcc
    74281 tgtagggatg tagatagttt tgcgtgtgga gttgaagatc tttatggagg gaattgtatc
    74341 tttgttccag atgtaggttt cgatcaataa gccgagtttg gcaatttctt ttgagggaat
    74401 catgagagcc ttcagttcat cggcgcaaac gtacatggcg tcgaagtatt gtatcgtata
    74461 gctgttcggt ttagctataa attctctgga tgcttttaga tggaaaattg caaattcggg
    74521 gggagacaga ttgatcatct cccatggttc cgggatgtag caagggagaa agttgattga
    74581 gaattccaca tctcctggga gaagcattag agagtgctcg gataagttca ttagaaaaac
    74641 tgaaatgtcg gtttcgtcgg ttattatttc agtgacgcat tcgcagaata cgtcgttgct
    74701 gtggccagta ataactccga agaaaccatc tgggatgtac agggaaatat ctagttttac
    74761 gattcgaact tgatcgtgcg gcacccatat gagttctcta tttacgagtg tgattttgtt
    74821 ggtgtccata aaaacgtcca ttttactatt cctgtgatgg cttactaaaa tagatggttc
    74881 ttccgaaata caagtgtccg tatttgcatt tctttttgcg cggtgccttg ggtagaaagt
    74941 tactgggttg ccgcgtttcc tttcatagtt aacacaatcg gtttctcttt gcttctcttt
    75001 tttgcaggtc ttcgacactg ttccattttg cggaatacct agaagcggga ttgggcgttg
    75061 ataagaggtt agttcgtttt ctagaaattt tttaaatgat ttctcattta cagccggcca
    75121 cacgtcgtgc gttttgtctt cagatatgtc tgtagtccaa agttcattga tgtccacatt
    75181 tcgaaagacg aaaaattcaa tgtatctcga gctcgtttgt ctctgtaggg taatcgtttc
    75241 ggagatcttt tctgaaattg cgctgtacat ttttccaggt gacagagagc tgtctgctgt
    75301 taatcacgtc gacgcgaaga ctagttgaaa ataacgctta agatgagttg taagaaaagc
    75361 gcaaggcaaa gcttatatgt cagtctctgc ctcttttaca ttcttgtttt tgcggccgct
    75421 acggaagtgg acttttattc tccagagtgc cattcgcata cctatgagat cgtcttgaat
    75481 tcattttctt cgatctggct tttgataaat ctttttttat tgttatgttc tttcgcgatt
    75541 ttcttgaaat actggtgtta taagactttt gcttcagaga cggtgaaggg ttattagatc
    75601 gcgtgagact tctattttaa ttataaatgt agcatacgac aaataaaagc atttttgttg
    75661 tgattggatc ttgttttatt atcttcaata gattttataa cgacaaaaga caaaactcat
    75721 ttcaaaattg agtttttatt gaagactgaa gatgagcagc tttggcaaac gtatgcagtt
    75781 atgtgctgtg ttgtttaaat cgcgtcgttc gttgtatgtg tgatgcgttg cattttgggt
    75841 tgagtatgct ttggtttcag tagtgaggtt atctggatgg ttgtgtgagt ttttatcggt
    75901 gatgtggtag tcgttgtttc caggtagagt tgcgttagcc tcccgacttt ttgtagaact
    75961 tttttaaacc tctgtagatc gtcccgtgat tgtttggggg tagatgttag tcgtttgtga
    76021 cgagatgtta gcttttgtta gtttggctga ttgagttcta ttgctagtcg ttagctgtgt
    76081 tgtgatatga tctgtccacc ttagacttgt attcgttaat ggttccttag gcgttgttgt
    76141 tagtaagttt gaccaggtta tgatgttagg ctttgaagat gtcgttaaga acgtttcagc
    76201 ggtgaaggac cgttgaggtg tagttgattt ttccgatgtg tgagcgttaa gaattggtgt
    76261 tatttgtgct atttctgtgt ggtttatctg ttcgtgagtg gacgctgaca ttctagtatg
    76321 ctttacctct ttagtgactt cagtgattga gtatgatgaa ttactagatg gtaaagcgtt
    76381 gttagttatg tgtacttcag ttttggcagt tacattcgac ggtagttttt gttttggagt
    76441 gacagacaac gtctgaatgg taggtagctc gtttgaggat ttcaaggttg tcctctggaa
    76501 tttgtcggtc atgttttgta cttctgtgtt gtgactcatg tatgtgcgta ccgtgttttg
    76561 ccaagtggta aactttaaaa tcggagtggt gtgttcggcg tcggtgaatt ttgttgtact
    76621 ctgctgtgat ttgctcttaa gataaataga gttttttggt gaagaatagg tattgccgtt
    76681 aatttccttg attcctattg ttgtgaaggt ggtgctttcg atcttttggg ttgcgtttgt
    76741 tgttgctgta gcgctctcaa gggttttggg aattctgatt gtggtatttt caaaatttgt
    76801 tggttttggt ggactttttg ggttttcggt gttttgttcg gttttaatag tggcgttaag
    76861 acggattgta agagttggaa tgtcggttgg ggtgtacatg ggtcgaggaa aatctgaacg
    76921 tttaactatt tttttgatgc tttccgttgt ttgcgttgtt atagtgggtg tgttcggtgt
    76981 aacttttatg gtgtctgtat gcagttttgt agagtttttt gttacggggg gaggtgctgg
    77041 ggttggtatg ttggtactag ggatatgtgg tgatgtgaga gacgctgacg tcgatgatgg
    77101 tgtagtagtt agtatcgaat caaagtttac gatggctcgt ccaaaggaag tggtaacatt
    77161 tataggtttt ggcgactgtt tgaaatattg atcatttgaa gggacgcatg atgttgtgtt
    77221 atagagcaag aagtaaacaa agctggtgta attaaagaag ttttttgacg tgaaggaagt
    77281 caatgaccgt gtcagattcg agttggaaaa tttgctcatt gccatccgca aggattcttc
    77341 ggttagtttt atgtcaaata actgtgctcc cagaatttta aatggtagta actctacgca
    77401 tggcggatct gcggtatatg tagatagtgt ggcaaacaga agataaaata gagaaaaact
    77461 gctagcgatg atagatttgt ttgcagtcgt cgaggatagc actattttga tttctgtccg
    77521 cggtaaattc tgtaatggag acaagctaac cgcagacttg cattgtgaat ctcgaatgtc
    77581 ccaagagaaa acgttagtta aaatttgagt gaagcagtcg agggatagat ttgtctgaca
    77641 aaaacttgta tataagtttc ggaggtcgta aaaatgttct ctttgttcgt cgctccaatt
    77701 gtggcggttg acggttttga aagcttctaa gggatcagac gtgtatttta ttagattaac
    77761 ggagtgcatg actatcgcga aaaggcccag aaaaaggccg agtcgcgaga tgtgaagcat
    77821 gtcgggtgag ttgaccacaa tgaatttgta caagtagaat gtgtgactaa aatagtattt
    77881 gcttttttta taggattgga cgatgacctc caaatgcatg ctgtgttgga ccgcgattac
    77941 gaatgccctg gctattttaa tgttattact agtaatttac cgggcgataa tcggatttaa
    78001 tggcgatatt tatacgagca cgttgtcggc gtttagctgt atacggacaa attcatctaa
    78061 tacctaacat aaataaaacg tttattcaac acaatctgat aagtctatat aatccgaata
    78121 aagcaattat tgcgatcaga atataaatga taaccaatat gatagacact tggtctatat
    78181 cgattccgac ttcagacatc tcaaaaacag agccgttttt ggctaacaaa agatagtgcg
    78241 tcctggtgtt gggaacaagt aaattgttgt tgggatctgt caatgttttt agttcgtcta
    78301 tgttttttat gtaaatgtat tgtaagggac cgtcgatatc atcatattcc atgactacgc
    78361 tctgacagaa ctcgcatgtt tgagatgaga tgtttcgtag cacaagcaga tcttgtcctg
    78421 catatttata gttggttgaa acgcaggtgg aattgagagg tatggctgtg attattatac
    78481 tcgtagccac aattgtcgtt gtaattgtta ggctcactcc tttaatcacg taagagggag
    78541 aaattacaaa tgtcacattc ggcagagtca gagaagctgc tggttcactt ggggagagac
    78601 actgaatagc cgctactctc tccatatttg gcggtctgta tacggatagc atctccatca
    78661 tgtctgatcg ataacggtca agggaagcgt acgtgagaac tgtttttaga aaagaatttg
    78721 tcacatctct gcgtacgggg gaggcacaag gcgaataaat attttctaga ttcggtgccc
    78781 tgtcagctgt aagcatgcgg gcccatgaaa ctatttctac ggggttacac aggtttccaa
    78841 ttagtagttg catgtgcctc tgcatgcgtt catcggtagg gatgatattc gctatttcgg
    78901 ctagcatgaa tagagtttcc ctatcggaaa atgtcagatt agtaaaaaac atgtgttttt
    78961 catagatgtt ttgtagagtg ttggcaatgt cagtccactt gtacttggaa atcgttacat
    79021 tggattcgta cgctgtcgct aagtacgtga gcagcgtaga tacggaaatg gatttgtttt
    79081 tggttatgta gctatagtcc gagggctcgt attttaaaaa ttccttcatt tttgggtatt
    79141 gtaacgtacc ttccgatacg ttcacacatc ggttgacaaa tgagtcgatg gacaggagat
    79201 tttcgtgtgt ctttaacact cttaacacgg gcattggtcc tgtgtttttt gtgctatatg
    79261 agaaatgtac gataccgtaa agaaacatca tctgcggtat gccggcatag ttgggttttt
    79321 tacagtctcc tcttaatagg gtttggattc ctaggttatt aaatttgagt agtagagctt
    79381 ctacttcatc tacgtcattc aacgtttcgt ctacgaatgt cgcatctgat atgaaacggt
    79441 attgtacatc tattacgtct ttttcgacta tcaatagtaa atcgtctgtc aatgtctgtt
    79501 tgaatatgaa tgaacttttc ttataagggg ctttaaagtt tatgctggtg gtgtttccgt
    79561 acatcatagt cagatctccc gcgggattct ggatgtacag tatcataaag tccggagtaa
    79621 agaaatgggt atagatgtct tcgcccacat agcgcgtaat tttagcgcat ctgacttgga
    79681 ctggaaatat tagttccttg agagaattag gcagcttaca ggaaacgttg tcgtattgca
    79741 tctgtcgaac ttctacgacc ctgacgtaat aaattccctg tgaagggtac atgtttaagg
    79801 aatacacaac ctgcggttgg atagagcgat ctaagttaaa ttgtttgacc gaaggtacag
    79861 gagaaagtct taaaatatcg ttcattggcg gctcataaaa acgtgtaacg cgtttttcat
    79921 aatttgttaa cgattctgtc gtgttgatgg catcaaacag gtggtatgtg atatcggagc
    79981 cgagtaagca tttagggact tgatatatcc gagtgtcgtt ttttgtataa aagttaaatg
    80041 ttataaagcc ggggcgaacg attggatttt caaagtttcc atttctacaa tggctcgagt
    80101 tcgatatgtt caacggtctc caaccgtaac agggagtcaa caggacaaag acccagagtc
    80161 ggaggagcat agttgttctt catcgatgaa gtgtgaaacg gttctgctat tctttgaaag
    80221 ttgaacactt tttgatcttt ccatattaaa tagattacaa aaatgatgtg taatggaact
    80281 cggaattgtt tctaaattct ccgtgtcttt tttttcccgt gaaataacat gtctctgaca
    80341 ggtttgcctg atatccggaa aaaaattgga cagtttcacc acttgaggat atataaacag
    80401 atcttatctt tacaaggaaa ttttgcgcga ctaaattatt ttttaggaga cgtgtttccg
    80461 gctaatttgc gatcggcatc tgtctcggtg tttttcgagg tgcgtctagg gccgcgcatt
    80521 ccggattgta tcgtcttgct aaagagtgta gatgccaaag atgagtttgc ttttcattgt
    80581 tattttttcg agtttaagac gactttgggg aagtcgacga tgcagtctgt gcatcacaac
    80641 tgcattcacc aggcgcaata tttgcaaggt ttgagacagt tgcaacagtc tatttcgttc
    80701 ttggatcaat atttaatcgc agacgaggtt tcgtggaacg ttgttcccgt aatctgtttt
    80761 ttcaggcagt ggggactcaa gttagatttt tttaaaaagt tttcggggaa gaccaagcgg
    80821 ttgtcatttt cgtttatacg tgatttgttc gccaggtctc aggatggcgc agtgcaatct
    80881 cttttatcaa tacccaatta caccaatttt agaagggcat gtcagaaaca tactgatttg
    80941 tacagaaaaa gatgtcgaaa agctccaaag tcagtcctca ctaagacttc gggagaaaat
    81001 agatcaaggg catcgcgaca agttgctaag aatgcgccta aaaaccgaat tagacgcact
    81061 gcaaaaaaag atgcaaaaag acagtgacgt tttgaattct catttgaaag cgatagagga
    81121 tgctttgctg tttacgaatg atggggaggt aaacgtcgaa acgaaagctg atgcgcaact
    81181 gataccgaaa tctcctgaga agctggaaaa attcaatcag gtcgctataa ccccactcga
    81241 cccctttata agatttacag acgattttag aggagaaatg atcaatacat ttttcaataa
    81301 tgcccagatg tggaatttta cgttcgggtc ttggttctat aagctcaaga gggtttttta
    81361 caatgagccc ggtttaagaa gggctttaaa acttactaat gtggattctc tgactatttc
    81421 aaaagagtta ctagcagtta ccgtcaatgc gttggagcaa gcgacggtgt atcctatatt
    81481 cggaagtgaa atgtcagacc tggaagcagc cttgtgtatc ctggcagctt tttattccac
    81541 ttatgagaat tcacagatcg acgaacgtac aaccctagta gatgttataa ccctcctgcc
    81601 tgtgatattc agattactcg gcagtgaaat tacagcattg aaaaatgtct ctccttctgg
    81661 cacctatttt ggatttaatg atccttcttg tatgaaattt tttgttccca tgagaaaagg
    81721 caagcattat gcagaaaaca cattcgggaa tcatgtgctt ataaagatgt tgctaggtag
    81781 aggggtaatg caaaaaattc ccggtgagaa aattagccaa aattttgatg ttgaagctcg
    81841 tttacacggg gccattaaga atgatgtttt ggtgtattgg acatatcagc taatgaggcc
    81901 aaaattggga aataatgttc caatcttcat acacgatcaa cattatttac ggtctggctt
    81961 ggttgcaatt gaaagtcttt ttttattgtg gcggatcctg aactcagaaa gtttgtttaa
    82021 caagagagtt gggaagtttc tcttaacttc gatttttcca cagttggaga atgtcgattt
    82081 cgccgaaaat aactttgaag ctggaaacat tcaaaatttt gaatacttaa tgcaccatta
    82141 cgttgtgcct atgtacaacc tgcagaatga catatcaatt tcgactcttt ttcccggtct
    82201 cgtggccgtg tgtgtaaatg agagtgtgag attgggatgg gaacataagt gtgcgggggc
    82261 tccgtccgat gccgttcagg ttcaatctaa ggaaaatccg ttcgtggagt atatccgcgc
    82321 tcaaatggaa caacaagcgg atgtggcgat acttgaaaag catgactgca ttctctttca
    82381 tcttgaaaac ggtttaaaca tcactctatc ttttacatta ccgagacaga gattgtttgc
    82441 aatggcttct tcattattta atgtaaatga tacttatgat ttcatctatt ttctagtttt
    82501 gggttttctg ccaataccgg ccgttatata aggcgggatg ttgtgttgat tacgtcaata
    82561 cggatggggt tttggatata aagacttaca gagcttttaa agaatcatta cttcgtttat
    82621 tcaggatgga gaaagaaacg aagtctttgg cttggccagc cactgcggag ttttatggtt
    82681 gggtatttat tttttcgtcc atacagttgt gtacaatggt tttactgacg gttaggttta
    82741 atagttttaa agtcggtcga gaatacgctg tgtttacatt tgccgggatg agctttaatt
    82801 gttttttact tccgataaag atgggattgt tgagtggaca ttggtctttg ccgcgagatt
    82861 tttgcgcaat tcttctctac atcgatgatt tttctatcta tttctcctcg tggtcattgg
    82921 tgtttatggc gatcgagcgc atcaaccact tctgttacag cacaccgttg ttgaacgaga
    82981 attccaaggc tctggcaaag gtgtgtttcc cgatagtttg gatcatatcg ggagtgcaag
    83041 ctcttcagat gctgaataat tacaaagcaa cagctttgca gaacgagacc ccacagtgtt
    83101 ttctcgcgtt cttaaggagc ggatacgaca tgtggttaat gttggtttat tcggtcatga
    83161 ttccagttat gctggtgttt atttacatat acagcaaaaa tttcatgctt ttgaaagatg
    83221 aactttcgac cgtgactacg tatctctgta tttatttgct gctaggtaca atagcgcatc
    83281 tgccgaaagc tggcttaagt gaaatcgaga gtgacaagat tttttatggt ttgcgcgata
    83341 tttttatggc gcttcctgtt ttaaaagttt attatatacc cgttatggcc tattgcatgg
    83401 catgtgatga tcacactgtg cccgttcgtt tgtgtagtat ctggctggtc aatttgtgta
    83461 agaaatgttt ttcgtgtacg cggcgcgaaa aggagtcgga tttagaggtt ggaataaaaa
    83521 tgttaaaatg agtaaggagt ttatcgtttt tattcataag agaatagatc ttcggcgctg
    83581 attcctgtaa ggtcaaatat ggcagagctg tcgagtaatt gtggattttc agacataccg
    83641 cagaagactt taaagtcgtt ttggagaaat gaaaacagtc cggctttgtg ctcggctctt
    83701 tgctgactgt acgccagtgt ggatatctca aattttccaa acattataag ataggcaaac
    83761 cataggtgtt tgcagatgag ccgcactgtt ggttctcgtt cttgatcccc ccaaaatcgg
    83821 ttaaagaatc tgcagatttt taaaagtcgg tgattataga tagctccaac ggagaaaact
    83881 atattgcctt cgcagattaa ttcttccgga attttgagat ttacaccaaa ctcgtccatg
    83941 aaaagaaaat taatcatgtg actaacattt ccgctgtagt gcagcttttt tgagatatat
    84001 gctgagtgac tttcgttaaa catatgtcgg agtagttccg cgtcagaatg ctgtttcaga
    84061 atagaaaata ttcgaaacca gtagttgttg ctgattttac gattcaaaat cactatgtct
    84121 ccgattccag aattgtacaa actttcgcgt agtagtaaga tcttgattcc gtgtgacagc
    84181 attgatgtac atacgtgttg aattaaaagt aattcctctt gtttaaagct agtcagattc
    84241 tcgtttctaa gcagttttgt ggttatgtgt aatattaaat tagggacggc gtcgttcaat
    84301 tttatgtact gtcctatctg ggtcatctca aaatgtctaa agtttgggta ggtggattcc
    84361 tttgtgttta tggtgaagaa ccgtcggaag aatgtttagc tctgcccagg gacacggttc
    84421 aaaaagaact ggggtccgga aatattcctt taccgttgaa tattaatcac aacgaaaagg
    84481 ccactattgg aatggtacgc ggtcttttcg atttagagca tgggcttttc tgcgttgcgc
    84541 agatacagtc tcaaacgttc atggacatca taagaaatat tgccggcaag tcaaagttaa
    84601 tcacagcagg ctcggtaatt gaacctttac caccggaccc ggagattgag tgtttaagtt
    84661 caagttttcc tggtctatcg ctgtctagca aagttttgca ggatgaaaat ttagacggta
    84721 aaccgttttt tcatcatgtg tctgtatgtg gagtcggtcg gagaccggga actatagcga
    84781 ttttcgggcg agaaataagc tggattctag ataggttttc atgcattagt gagagtgaga
    84841 agagacaggt tttggagggg gtcaatgttt attctcaggg tttcgatgaa aatttatttt
    84901 cggcggattt atatgacttg ctcgcggata gtttggatac atcttatatt agaaaacggt
    84961 ttccaaagtt gcagttggat aaacagctat gtggtttgtc taaatgtacg tatattaaag
    85021 ctagtgaacc acccgtggag attattgtcg cagcgaccaa agttgccggt gatcaagttc
    85081 agttaactac ggaacctggg tctgaattag cggttgagac gtgtgacgtg cctgttgtgc
    85141 acgggaatta cgacgccgtt gagtctgcga cagctacaac ggctatgagt aatcaaaatt
    85201 tgccaaatac tactcctttg ctgtcgagtc caccattttc ggattgtgtt tttttaccga
    85261 aagacgcttt tttttctctt ttaaatgtta caaccggaca gcaaccgaaa atagttccgc
    85321 ctgtttctgt tcatccgccc gtaactgaac agtatcaaat gctaccgtat tctgagtcgg
    85381 ctgctaagat tgcagaacat gagtcgaatc gatatcacag tccttgtcag gcaatgtatc
    85441 cctattggca atattccccc gttccccagt atccggccgc gttacacggt tatcgtcaat
    85501 cgaaaacgct taaaaagcgg catttccaga gtgattcgga agatgaatta agtttcccgg
    85561 gagatccgga atacacaaaa aaaaggaggc gccatagagt tgacaacgac gacgataagg
    85621 agatggctcg agaaaagaac gatttgagag aattggtgga tatgatagga atgttaagac
    85681 aagagattag tgcgttgaag catgttcgcg ctcaatcgcc gcagagacat atcgttccga
    85741 tggagactct gcctacgatc gaggagaaag gcgccgcgtc cccaaagcca tctattttaa
    85801 acgcttcttt ggcgcctgaa accgtaaata ggagccttgc tggtcagaac gaatccacgg
    85861 atctgctgaa actcaacaag aaattgtttg ttgacgcgtt aaataaaatg gatagttaaa
    85921 atgtattttt atgttgtgat caagtggtgt ttagctgtgt gttataagga agattcagag
    85981 tgaattcctg gacatggtga aacttgacac ataattgttt accgacgcgt tcaataaaac
    86041 gaatggttaa aagttgtttt ttgttttttt tattttcgta taaaatggta tttaggcgct
    86101 agttacgggg aagatctatg ggagtgattg tgacaaggaa tgaaatgaat gccgacatct
    86161 ccttctaata tcgttaggtt ttgtggggtt ccaggcggca tgaattccat gcgagtagat
    86221 tctccgggtt ttagagaaaa gtgcaagggt accatatgtg cggtgtcgaa cgcaacgcgg
    86281 agtgaactca aaaaaattcc catgttgatg tctggcgtta agtttgcaac cgtgcttaga
    86341 cttggtgttc gcaatactgc ttggtttgtg aaagttacgg tgtttcttac gggaccattt
    86401 ggagattctg tgtttacata aattttgctt gcttctgtcc agttgaattc gacattattc
    86461 cccggtggta aaatttgttt ggggaagaag tatactacgc ctataggttg cgagtaattg
    86521 atgcgacggt tcttcttaaa tgctttcatg gtgatgtaga gaggccgtgt ctcatcccaa
    86581 atgccggtgg ttgtagagat tccgagcaag agtttgggta taaataaacc cgtaaagttt
    86641 gaatttgaat taaagatagt gttaaaagaa caatggacag gagtaaccgt gttagggatg
    86701 atatttttag ttgcgcagac agttattgaa tgggtgttgc attttagaag tgtttcttga
    86761 ttctgcgaca atgtaatgtc tgcggtttgg ggggtcagtg aaatttgtat ggcaagttgt
    86821 tcaggataaa aattatcgtc aaggagatag tcgttttcgt agtttgcctt caaaattaat
    86881 agatttccgc agagtaagat tctagaaata tagacgtttt tgtgtgatat aaattcgatg
    86941 ttaccagttt taaaaatttg gtcgagcgga gtgttttgga gattaaccca tatctctgcc
    87001 ttaaatgaat atcgtgttgg ctcttctggt gtttgttcta tccatcgtat atcagccact
    87061 tgaattttaa tacgcgtgag agggccatat atgacaaact tcgcgtcgca ctgtccgtgg
    87121 ggtataatgt ggcgatcgtg ggcttcgatg cgttgcaccg gtaaatttga tatattcacg
    87181 tttgcgtgag gaagtgcaaa tatattaagg acgataggta atctactgag atccagatct
    87241 agatctgaga tgttctgcac cgcgaagggt atgttgccgt aatcttttgg atcgatgtaa
    87301 gtaaaaggcg atgatgtaaa actgctttcg tctctacaaa tgcacactac ggcggatgaa
    87361 gggggggtga tacctaatcc gcatttaaac aatctcagtt cgccgggttt taatatggcg
    87421 gtagttgtta ctcttagctg tagtacgtac gaagaccatt gtagagtggc gggttgcatg
    87481 tttgcttttc tggatgtctg aagggaatcc tgttagtgta ttttggatgt taaatagttg
    87541 atgtaaacgt agagagtcat atgcgtattt ttataataga gtgtttttcc acggacggga
    87601 gagtctgcgg gtttccacgc gcaggcttgt cttcgtattc taagggatgt aatgtgagtt
    87661 ccggtagcaa gtatgcagga aaacaattgc ccatgaagtg tacgtcgaat ggtttatcgg
    87721 tattctccgt gtgtgttaaa agagatttca tgtcgctgtt tgagagtgaa cgaaacggct
    87781 ttctaaacaa cttcttcgtc acaaaaaaga cacgccctaa catgtcgtgt tcggttacgg
    87841 aaactgttct ttcgcacgaa atccgcaatt ttaacggttc ttgggcaaac cataaaaatg
    87901 gatacagctt gaagacatgc gtctggacag ggatgaagat gcctacgatt tttttgttag
    87961 tgaactcgcc gcgtagcgtg atctctttgt ttgtattact tactaaggac atatcgttgg
    88021 gaaagaaaac ctctagattc ttcccgtctg cgcagatttt aaaatacggc atattcatat
    88081 ttagcgtgac ggtgctccga tcaggggggg aaaaggtcaa gcgaagataa cattctttcg
    88141 tgattggaaa ccgtcgcttg ttttccggca acactacgtt acgcaaaaag actgtgagaa
    88201 aaggatcgtt aaattctatt ttgtagatag agatgccggg ttcggaaatc atgttgactc
    88261 tgcagagtgg gatgatactt ttgaataggt tttcccaata gggacattct ctggtatcga
    88321 tgctgaacac gctaaaaact attagcagct ttctgccata gcggtctaat ttttgagact
    88381 gataaggact ttctgtccag tttaggttaa ataagatcaa agacatttca acgctatcat
    88441 tctgaactac tttaaattga tttatcacgt tggttgtcga gataggcata ttggttaggc
    88501 catattgttc gtatacggtc ggatcgatgt tttctttttg acatagcgca ttgatgtcgt
    88561 caatctccag tgcatgtgac ggcagataaa tgggtatgga aaataaatga atccgtacgg
    88621 gaaccgtcct agaaataggt aaaattttta ttttgatagt cgttgttttt tcgagaaact
    88681 gtacatcgaa cagaacgtcc tcagtttccg attcagtgcc atctgttatg aataggattc
    88741 ctggttttgt gcttgagatt cgacatttca aaatgatttc ttggtaagaa ttcgaaacta
    88801 tgtgattgca atcaaaaacg agttgcaaga catggtttag ttgaggagaa aacatgctgg
    88861 tacaaaaaac attttatgtt tcatctccct ttttaaatac tgtgtttttt taagggatga
    88921 ggtcattttg tatgacggat ggaggacgcg ggtgtcccgg cggggtgtgt ttttataatc
    88981 ctgtgtatga gtgatagaaa agtcatagta ggctagtgtt tttttaaaaa gcatttaatt
    89041 tttataaata catgtagcca ttctgttatc tgcggaaacg tcacagacaa caaaatacgt
    89101 tttctcgttg gtcaaagaat taatttggtc gatcatagtt aagactgatt tgactttttt
    89161 taattcatct ttaatttccg tagcgtgaag ttgtccgcag cgctgtgtgt ttaacgttgt
    89221 tcttttagat aatagttctt ggcatttgat caaaagcatt gaatggtctt ccagcgttag
    89281 ccgatctatg taagttctca cgatgtctgg ggccatggcc gtgatcatgg acagcgagat
    89341 gcaagctgtt ttcatggagt acattgattg tttgtcgttg actatgtctg gtaatttaat
    89401 gagtacgtct ctgtattgga tagagcataa ctcatcgatg attgtttgca tctcattgta
    89461 ttctctgtga actgctataa gaccaatgca tagcaatctg atgttgatct cggccgcaat
    89521 ggctgtcgga acgactaaag gtacagtgag ctcccaatca cctagtttca atagcttttc
    89581 ttccgagtgc gtcgataaag gtggaatcaa tgtcaaggtg tcaccctttt cccaggggaa
    89641 gggtcctgtg ttctttatgg catactgatg gccggtcacc ggctttctca aaaccagttg
    89701 attgccttcc accttttgca gaatggttac gaccatggtc cgtaatacgt ttcggacgtg
    89761 gacgtaatct ttgttggagg agacgatggg ataaagacct aaattgccgc tacctattag
    89821 atggtggtga gctgggatcg gtatgacgat gttcatgagc ttgcataggg tgctgatatc
    89881 ggaaagtgac agtttgtgat cgaaagtgca gtagacggtt tccattttat atggatgatt
    89941 cgataatgag ttggaaaggt atggtttctc ctatggcgta attacaataa tgggtttcgc
    90001 tgatctgcgt attgccggtt ttagaccgac tctctaatag agcttggttg gatgaacagt
    90061 gaagaggcag agcgttttgt aagaactggc atggtctgct tacgaagcta tccgtgccct
    90121 cagagcacga gtattgtatt tcgctatcgc tgtttaaaca cgagttcgat ttcatgcagt
    90181 attcgcttat cactttgtac atcatcttgt ttgtttttaa gatgtcagat tcggtaaaaa
    90241 attgagcgtt gggactgtat gtcttggggt tgtaacatag ttgttctctg tgtgccgtgt
    90301 tgtatagaat atcgcctaag gagcctggta gagatgccca agggtttgtg gttgcggcga
    90361 atgtatcgct gtctgtttgg gtgtggtcgt acaatgcttt tctagccgcc tcttcgttgt
    90421 gcgggtccgt tcccatcata catgattccc tgcctcttgg gttgtggggc gatttgaaaa
    90481 agttaatgtt tgtcgtaacc ggggtcagta taacttcgca gatagcttgt tgaccatgca
    90541 gtagtatgga gggtgggttt ttgttaattc cgccgaacgt tatgatgttt agtgcttcgc
    90601 tctcggaggg attaggtttt tctatcccga cgtgatgtcg aatccacgta tttatgtccg
    90661 cgttggtaaa cgcgtgtatc gggaaggcgg agaaaaggtt ttgtatcttg ctccccatat
    90721 ctgatttaat tcgcttaaga ttggcagtgg cggtggtaga gctaaaacct aagcccatat
    90781 ctacaaaact taggtgctgg gtgaagttgt aagtggttgc gatatcttta gcttccgcgg
    90841 tgaccgtggg atcgtctaaa attatagatg tggctgctct ggaactgtat aataggcact
    90901 cgacgtcgaa attatccgtc cggactagtg tggccgcaaa gcccggatgg attttgtttt
    90961 tgctttggat cgctatggca acgggagaca attttgagtg catggcggca agcgtcataa
    91021 tgctcaacag ggaattgggg cagaaggctg agtacacgga aaacggtgtt cgttgccaat
    91081 tataaaattc taatgctaat gggggcggga gaggaaaacc gccgtcgttt ctttgacagt
    91141 gaggaaatgt atttaggaaa acttggatat cagcattcat ggtgccgcag attcccgggt
    91201 cggagaagaa tcgatgaaat gggattggtt gatagtaccg tcttagggtg gtgatcggtg
    91261 agatcaggca aagcccgttg tatagaatgt gttgtagtga ttgaaaatga acggagttgc
    91321 cgtgtcgctg cgcgggatct aaggagactt ccacttccaa tattttcgta ttttcattaa
    91381 tgtagattag cgatttaaac aactgttttg cgatacagga tgtgttggct acggtgtagc
    91441 cagggcccat accttctcgg atcagagaca ttagaacgtc gctggtaatc ggattctcct
    91501 ggaaataatc atctggactg atgaacggtt ccgtgtagaa taagtctaga actagttcct
    91561 ttacgttgac gccagcgcca caggccttgt tatttgatag tgccgggagt acgcagaagt
    91621 aaaatatctt gctcaggatg gtggtttcgt tcgatggtct gtcattgtcg gtaaagacga
    91681 cgcttgaatc tattagattc attctttgca catcggatat ttcgtaattt ctaactctta
    91741 cggtgttctg tgtcagtggt gtatcatccg ctgttatttt tgcattcgtg tcgtttctgg
    91801 gcatggtatg gacgaacggg cagaacagac gtccgtcgaa caacgcgttg gcgaaattca
    91861 ccagaggttc gccgcaaagt tgctcgttga ggttggagat agagattgtt ctcttcacta
    91921 ggcgaattag cgacacaaga tttctgtagt gagcgaaagc tgctcccggg atcagttcgt
    91981 cgcccatgtg gttagagatt agcatgatca tctcgaagct gttgcaaaaa agaagtatat
    92041 gtttcatgtt aaaccaataa gaaatacact ggctaattac ttgttttagg atcataaaag
    92101 catgcttgtt tccatgcact aaggtctcga taacgtaagc caattctggg tacgagccac
    92161 tcgtcaagct ttcggtgaca attttgaggg tgaagtcgta gttttggcag ttcgtctttg
    92221 catgttccag tatttgattt gtacgggctt cgtggaaaga gactggagct aacggtaaag
    92281 gtatgttgcc tatcattatt cttggtgtgc agagtacttc tgtggctcgg tttttctgga
    92341 tatacgtgag atcgaagaag gggtgtcttt cggtcggcag tgttggattg tccggtttgt
    92401 aaaaatcttc aatgtttaat tcgtttttta agacgttggt gtttttgggt acttcttgtc
    92461 gactttcgta taagttgtat aaggtctgta agatcctggc tgggttttct cgggtaattt
    92521 ttagttgaca tagttgggaa aagcggtggc cggtaggcaa tggttcgctt ttcatgagtc
    92581 gttcgacgat ggtcgagtcg tggacaatgg gatggcaaac cgacggtaat atgtcggcaa
    92641 aatcaattcg ctgcacgact tggtctttat tgtggaaaaa aacgctggtg ggtaggttgt
    92701 tttccatggt gtcgtttaat ttcacacgtg tttccattgt actgaaaccg gtctcgctcg
    92761 gtatgtagat acccaaaggg aaaaagaatg ttagttgtaa gctctgttct agcggatcgt
    92821 tgacgtctgt gtttttgtaa actttgtgta ggtggtcgaa tgcgactaat ttatctccca
    92881 atttcaacgt gttcagcttt aggtcggcgt acgcgcggct tttgtcgaag atttctgatt
    92941 tgttgttagt gtcttgttgt tctgtcccgg cgttcacggt gaattgagta aaatcggcca
    93001 tgattgcacg gtatgcaatc gcagtcactg cgttttcttt gcccataata aagtgaccat
    93061 atgagattgg ggcggagacg acttgtgtgg agatgtactg ggagagtatg ctggtgagtt
    93121 tttggataga gccgatcggt cctaataaaa caccatctag ggggacgttt tctttggaag
    93181 tgtagttgtt cgtatcattt agaatgcttt ccgtgaccga ttccatcatg tcgtttagaa
    93241 ttctatagat atatgaaata ttattattcc tgttcaaaaa aaataatgac gttaacaatc
    93301 tgttcttcag gctctgaaac atgttgctgc gctgtactcg gctcagagct tgtttattat
    93361 gtactttgtt ctcattcatg gtcaggacga taaattgcgg gggagatttt ctcaataagg
    93421 tttgcatgaa tgcgtgaatc aaacctcgct cgagcgaatc ggctgaattc tttaaagatc
    93481 ttaagactgt atgtaacgca ttgatgttta aaatctgatc gatgactgtg tttttaaatg
    93541 tgttttccag atgttccaga caggcagcgc tcaaatcgaa cgatatgttt atggggtgtt
    93601 tttctgagtg tttggctacc atgatggtgg tttcttttga agcagttacg tcgtttcctg
    93661 tagcgactct aggtaattga ataaagaaga gaaccttccc gagggtcatt cgactcacat
    93721 cattgaagcg gattacgttc gctgcaacgg cgatcggcgt ggtgaaaaag ttaatccatt
    93781 ctattttgtt gcagtagatt ccgagtaagg cttcaaaact gatgttgtaa cggctcggat
    93841 cgtcaccgaa ataaattcgc aaattgtcaa aaagttgttc ggctgtgtat gttttaatgt
    93901 cattgaaaat atttagaggt gcttcgatct taggtaaaat ttcggtcgcc tgccaatttt
    93961 ccatgtttcg gcgttatgca gcacaccggt aattgtgaaa ctttaatagt taattcatgt
    94021 tttggttcca cttgtgcacg gtcgattcca gtttttatag attcgtgtga tctgaccgct
    94081 gaagtgtctc gcgacgagga aactcgttta gcgcgatccg tgcctgtagt tctggaaaag
    94141 atcgagtcaa tcatagagaa aatttttcaa acgtccgggc caaatatcgt tcacgataaa
    94201 gacagggcta aaattgcctt gtgtcgtctg ttgttaggac cagttgcggt gccatgcttc
    94261 tgtgaagagt gggacaccaa cgactatttg tcgaaatctg gctgtaaatg cataggtccg
    94321 atcttatata ttcataccag tcgatgtcgt tgtagcgaca ttccggtttt taagttttct
    94381 attatgaaag attactatgc ttcacacgtg ttcagaggtt tattatctct gaaagagtgg
    94441 aatacacatc taccgaatgt attgtgtacg tgtgagttgt cgatgagcga tagatatgtg
    94501 gcgacagtgt atcctaagca gaattctatt tatctagaat actatccgta ttttttgtgc
    94561 tacctgtgtc gccatcttac tgtcattgag attgagcagt gtacaaatga tttaatttcg
    94621 cttcttggcc ctaaagtagc tcagcgagtc ataattcatt ttaaactgct ttttggtttt
    94681 cgtcacaagc cgcatattgg tactgttgat tcgtggttct gggaaaattt ttttatgtta
    94741 gaattgcata agctttggtt aaccgtagtc aaacataatc gggtgacgac agattttttt
    94801 aatgtagtct acgagaaaat tcaaaactat aaacaatacg caatcaagac cctgaggatg
    94861 tcgtctaagg cggttcctgc aatacagagg ttgtgtttgg caaaatttaa gcagcaattg
    94921 ttgtatctaa atattaaggt tacggtaaaa aaaaataagc gagaaatgtg tttgaatggc
    94981 tttgtttacg gtaaaacatt gtatgtcgtt gaatcttctc agttaatctt ccggaatttg
    95041 cttctgttgt attacgatta cagtttgccg gacgaatgca agacaaacga agaaaacgtt
    95101 ttgacggctc attacatacg agtaatttcg agattgtcgt ttaagcggtc tcggagtgcg
    95161 ctcccgccag gcgtgagacc agattttatc tttgtggcac aacagcctaa acgtaaagag
    95221 ttacctaatg ttcccggtgg tatcgatttt gctgaaatta cctcagtgag gcatggcgcg
    95281 gtaactctta acgcgtttaa tacgaacaaa gtcatgaatt taaaagcaac catttcaaaa
    95341 agggctaact ttgtatatca tcgcattcct aagacgatga cccacagttt tgtcatgtac
    95401 aagcatacgt ttaaagaacc tgcgtttacc gtaagcacgt ttgtttcaaa cgatgattta
    95461 gatatgagtt cgttgaatat caacatacgt ggaccttact gcgacttttt atatgcttta
    95521 ggcgtttata agatgcatgt ttctatccga gatctatttt taccggcgtt cgtttgcaat
    95581 agcaataatt cagtggattt acagggactg gaaaatcagg atgttgtgag aaatagaaag
    95641 aaaaaggtgt attggatcac taactttccg tgcatgattt ctaatgctaa caaagtgaac
    95701 gtgggatggt ttaaagcagg aacgggtatt attcctcggg tgtctgggga ggaccttcaa
    95761 aatgttttgc ttcaggaatt aaataacgtt cgagagattc ccgggttagt ctttgatatg
    95821 gatttacatc aactgcttgt tttattggaa cagcgaaatc tacatcagat tccgtttctc
    95881 gttaaacagt ttcttatttt tttacgtctc ggtctgttaa tgggttacgg gcactctcgg
    95941 cgcaacaagg tgcatgatat tatgttacat ttaatttcga atggtctgtt tgattttaat
    96001 aagaactccg tagcaaatac aaaaatcaaa cacgggtgtg cgttggttgg gacgcggctc
    96061 gccaacaatg ttccgaaaat cattgctagg cagaagaaaa tgaagctaga tcacatgggg
    96121 cgaaatgcta attcgctcgc cgtgttgcgt tttatcgtta aaagtgggga acagaaaaat
    96181 aaaactgttt tcattaaatt gttggaatat ttagcggaaa cctcaactgc cataaatacg
    96241 cggaatgaag tcgccagatt acttcagact ctgacggcta aggtgaaaac atgaatgtac
    96301 tcgtggccga cgaatggttc gattgcgcga ttaggttaga ttcggaaacc atagctgtcc
    96361 atgagatttt caatccggag ttaagtaaac tgcttaactt gcactcgaaa acagtctaca
    96421 tgtccgacct atgcgctttt atttctggtt gtgttaatcg gaatgtcggt aaacttacca
    96481 tatattggca tgtgaacgga gatataatct acgcattgac gggtatttta cattgtgtaa
    96541 aaataaagat agagtgcggg gagagaattg ccgatggtcg atatagatta tacgaaattc
    96601 ctaaattatt tttaatgaga ggacagtcaa cacccatgga attgaagtgg aagcacgccg
    96661 tgggtatcgc gacgacgaat aagcctttgc tgacgcacgt tttaacagat gtgttggaaa
    96721 catctccttt taccttgcca gatacgcttc tgtcggtgca ggagttgtct attttcagag
    96781 agagattgtc gtacatttac tatgtgctgg ggtcagatgt tgatatcgta gcgcggacag
    96841 agagagagat ttttcaaaaa tgtgcagaac tagctcgcct acagcaagtg ttccttattc
    96901 aaggaaatat tatggaaaac tttgtcctcg cccaggcttg tctatttcag ctgggggctg
    96961 atggtttgtg ggaagagata tctggttctg tacgtcctag gccggaattg atgtccagtg
    97021 cgttcattca acacagagta atgttgaata attgttattg tatcgctgtc atcttcaatg
    97081 ccatttacaa acacaaactt tccctgccta ccgtagaaag aagccacgaa accgttaatc
    97141 gtgtagctca ggaatattat aagtcttatg tgaatgctcc tctctctgtt cttgtgtgtg
    97201 cgactaaggt gcttacttta tttacagaag aatataactt taagtcagct ctcgtatttg
    97261 tcagtcagtt tttccaggtg gacgtcgagg cttcgagagc ggatgtgatt cgtctgtttt
    97321 tagcgtgtct aaagggtgat taaatctctc ggaaagaggc tgaactgttt ccagagcata
    97381 cataaatcgc cataattata gcgataatta agtcgtcgga acaggcttgt tttttagcgc
    97441 tgtatgttat gtaattgtta acggagatct ggtgaatgtt tctgatttgt tctagtgcgt
    97501 attccacggg atcgtaggta atttttattg taaacgatat caattcctgt gacgccttga
    97561 tgtttcctga attaaaattc gagataaaaa actcaactgc tagttttttt tctttaccga
    97621 gtaggtaaaa tggctgtgct atctgatttt ggtctggggt gtggaaaaaa gtcacctgta
    97681 tagatttatt agccgtgatg ttttccttta tgatacatgc aatttttacg gcagaagctt
    97741 gattggaatt cccttctatg atgattttta cttccgtgaa gaaaggatgt agatctagga
    97801 ttgacaatat catatgcgcg gcacattcag ctattgccgt gtcggaactt gtcattaaac
    97861 tttctagaaa gtagtgctcc atgccgtaga cgatatattg atctagatag gtgcctattg
    97921 ctgctatgcc tgtgccagaa gcacggcggt tgcctgtata ggcagggtct aggtatacgt
    97981 acagatcttt acctaaaaag ggaattagat ttttattgat ggtgctgtat cggaaaaact
    98041 cgaattcggt ttggccttgt tccgtaatta aaacgtcgtt gatcacattg caagtggctc
    98101 cgcccatgat ttcatggatg aaagctcctt ctaggaagag gttggccgtt tttttaactt
    98161 cggcgttaat gctgatgaac ttgggtttgt ggagtcggta gcaagaacag gctgtggcgt
    98221 taccgcgttc gtttaacata tgggcgtgat cttcacatac gtaagaaact acggagagca
    98281 tttcaaacgg agagttgttc agcttcatta aaaaagatgt tgaatggttt ccggaattgg
    98341 tcgaagatat aaataggatc ttggtagatg cttggggcag gaaacctaaa atcgtgctga
    98401 acgcgtcttt ctttataaag tggctctcgt cgacaataag cagattgaag ctctgtccgc
    98461 gtatactctg agaggggaat gaattcggcg ttaaacggga taaaagacga ttttgagaac
    98521 tgtgaaacga aagacgacct ttttaaaata attgataaaa taagcaaaaa ttgcaatttt
    98581 atagtggaac aggtcgagtc tttgcctcgg agggtggatt cagcggccat cctatttgat
    98641 aatctcgcgg tggagatatt taacgatgta atatatcgac aaaatggagt tgccgcgaaa
    98701 atacgacagg gtaacgggca ggatattgac acataagaat aaccagatgt gtacaaccga
    98761 atgttctcag atgtataatt tacacaatcc tatcacgttt gagttgggac ttggaaacgt
    98821 gtttgtctgt atgcggtgtt tgacggttca ccactgtgat atgcaaactg actgtaccat
    98881 tgtcaacacg catgaggggt atgtctgtgc aaaaacgggt ttattttata gcggttggat
    98941 gcctgcatat gcagactgct tcttagaacc gatctgtgag ccgaatattg aaacggttaa
    99001 tgtcgtggtg gtcttgttat cttatgtata tagttttttg atggaaaaca aggaacgata
    99061 tgctgccatt attgatagca ttattaaaga tgggaaattt ataaaaaacg tggaagacgc
    99121 tgtgttttat acttttaacg cggtttttac taactcaact ttcaataaga ttcctctgac
    99181 gacgataagt cgtctttttg ttcagttgat tataggagga cacgctaaag gaacgattta
    99241 tgacagtaat gtaattcgcg tcagtcgtcg gaaacgagaa gacagtttac taaaaaagat
    99301 gagattggag tatggaaacg cacttatact atgacaccct gtatcaatat caaggcggag
    99361 tgtatccggc tcatatttgc ctgccgacag atgtgtgtct tccgatgaga gtggattgta
    99421 tcgagtcttt atattttcgg tgtgtatttt ttaagagtgg gatgcattat actgaatgga
    99481 gtaaattaaa gtttactgtg atttcacgtg aaataaagtt taaagatgtg ttaaaggatg
    99541 cggactctga cgaagttttt accggtttgg tggtaatgac tatcccaatt ccgatagtag
    99601 attttcattt tgatatcgat tctgtaattt tgaaattggt ttatccgcgg ttagtgcacc
    99661 gggaaatagt gctgagactc tacgatctta tatgcgtcag acctccgtca aaccggccgt
    99721 cggaagcatc agctaaaaat attgctaatg atttctatca actaacctca cgtgaaaata
    99781 aacagacacc cgatgaggaa aaacgttgtc tattttttca gcagggacct ttagagccac
    99841 cctctaccgt cagaggctta aaggcgcccg gtaatgaaaa gccaatacaa tttcccgccc
    99901 atgctaacga aaaaatgacc gaatcttttt taagcgatag ttggttcgga caaaaagtca
    99961 gatgcaaaaa aattttggat tttacgcaaa cgtatcaagt cgtggtatgt tggtacgagc
   100021 tttcgttttc ccgcgagatg cagatcgaga ataatttact gtccgcttcc cagctaaagc
   100081 gggttaacgc tgcggatttt tgggatagaa ctaatcggta tttgcgagat attggaagca
   100141 gggtattgac acacatcgtg aaaacgcttc agattcataa taggcaattt aaacagaaat
   100201 ttaattgcaa ttttccagat aatttcagct ttgatcgtct attatcattt atgcagctcg
   100261 ggaaagattt ttggatttta aacttaactt tagacagctg cattattaag gcaattatct
   100321 gtttcctagg ttttcaaaac gggggaaaat cttttttagc ccaagatgaa gtttgggggg
   100381 atttaataga ctgttctaaa ggatcggtga tctacgggga aaagatccaa tggattttgg
   100441 actcgactaa caatttatat tcgacgtgtc gggaaaaaca gaataagtcg tgggaattat
   100501 atgttgattg ctgtgctttg tatgtatctg aaaagttaga gttggatttt gtgctacccg
   100561 gcggatttgc aatcaccggt aaattcgcgc ttactgatgg cgatatcgac tttttcaatt
   100621 ggcgatttgg gttatcttag aaattttctg cagaatgaat gtaactggtt cagaatttgt
   100681 aaaaaaacat tctatcgcga atatcgcagc gttgcgacat cgtctcctac attctcgttg
   100741 aataataagc ctaagaaatt ttgcatgcat tgcgagattg taatattcaa gcgaagtgaa
   100801 gaatttatgt tcagccttgc ggtaaatggc atacattttg ggcagttttt aaccggaaaa
   100861 atgaaattta ataagaaagc agttccggaa gggctctatt actatatatt ggaattggga
   100921 agcataaccc ctatcgattt gggctttatt ccgagatata attccgactg tgttacaaac
   100981 atgcgttgtg ttacaccgga ggttatttat gaaaattgct ctattgtgtg tcccgaagag
   101041 gcaaatcgcc tcacggtaaa agggtccggg gacaataaat tgactccctt aggtgggtgt
   101101 ggagcatggt gtctgaaaaa tggtggcgat ctgtatatct atacttttgc actcgcttac
   101161 gatcttttcc taacttgtta tgacaaatcc acctttccat ctctggcaaa aattattttt
   101221 gatatgatag cttgcgaatc cgaagattgt gtcttttgta aagatcacaa caaacatgta
   101281 tcgcaagctg gacagattgt agggtgcgtc tctaatcaag aaacctgttt ttgctacaca
   101341 tcgtgtaaga aaaaaatggc taatattaac aatccggagt taatctctct gctctgtgat
   101401 caggaaatta ataagataga tattatgtat cccaaaataa aagcatcgtt atcactggac
   101461 attaattctt acgctcatgg gtacttcggt gacgaccctt atgcgttaaa atgtgttaat
   101521 tggataccag tcaggatcag cgcagctctg agcaggctga ttgttttgtc gtgtcctgtg
   101581 tgtaagcgtg tggtaatgga ctaattgtgt gttttatgta ttaatttttt atttctgaaa
   101641 ataaagttaa attgatagta cttacgtgtg tattgtagca gctggcgaaa agtgctgtgc
   101701 tctttatatt ttgatggtcg attgtaatta cattatccag gcatgtgatt gtcttttctg
   101761 gaaacattcg gcggcattta aactcgactt ctttcatcac aaagtgagat acgtgttttt
   101821 gatgtgccac gtaaccgatg ctgattcctt caatgttctt caataaaaaa cttataatag
   101881 gaactatgaa ccacgttttt ccatgtcttc ttgggactag gaatacgtta gttttttgtt
   101941 tcagcgtatt cagagtactt tcgtttacga attcaatgtc gaacacgtgg gtcagatagt
   102001 tgataacacg attggctaaa gctggaagtt tggtgacggc gatgaagaag attacatgta
   102061 tgagaatgtt cttctgaaat ggttccagtt gtattttgcg cgtgtctcca aagtcgttga
   102121 attctccttt gatccatttt ctgaaatctt tgataaaacc gtctatttgc aagaacagcg
   102181 gttcacgata tagaatctta aaggattcaa gaaattccgt gtattgtgat tcaaaggatt
   102241 tgtcggaagc gggtaaaaac ttcatttctt gtagcttgtg cgaaaggctc ggtagtatag
   102301 taagaggctt acggttttta agatgtcgct gtttttcaca aaatgtatat agaggtttta
   102361 cctgttggtt atatgaatgg gcaaagccga gttctggcgt gagcattata aaacgcttct
   102421 tatagaagat ggcactgttg gggtacttgg tagatattgt cgagcagtct ctttcgcctt
   102481 tccatatgat cgcttcatag ttatttttta tgtgggttat gtcgcaggta cgtagcatgg
   102541 agcccgacct tacgttggcg gcggtctatc aggcggcggc gaacctcaca gagcaagata
   102601 aggagatttt tgccgaagcg gtaaaaactg cgttttcagt gtgtagttcg gcagccccga
   102661 gcgctaggtt gaggatgatc gaaacgccta cacagaattt tatgtttgtg acgagcgtta
   102721 ttccttcggg tgtgacgtct ggtgaaaaaa aaacaaagtt aaatatcgat gccgctctgg
   102781 ataatttggc tttgtcgttt gcgaacaaaa aatcaaagaa gatggctaga acgtatttgc
   102841 tgcagaacgt tttgcggact caagatcaac aagttgccat ttcggggaag tacattttgt
   102901 atacaaaaaa acacattgaa acgtctttga tgatcgataa gacgaagtta gttaaaaaaa
   102961 ttctcgagta tgccgagacc cctaatctgt taggatatac cgatgtgcgt gatcttgaat
   103021 gtttactttg gttagtgttt tgtggtccta aaagtttttg ccagtcagac agttgtttcg
   103081 gatacagtaa gacgggatat aatgccgcgt ttccaaatct attgcctccg tatctgtacg
   103141 aatgcggcca aaataatgga ctgttttttg gcattgtgca agcttacgtg ttttcttggt
   103201 actcagattt tgatttttcg gcgcttgaga tttcagaacg cgctcgtcgt cgaatcaggt
   103261 cactcctgta cgacttaaaa cagaagtttg cggagcaaga agtttctgtt ttatcggtag
   103321 cgtcacagat gtgtatcttt tgtgcattat ataaacaaaa caaacttagt ctagaatacg
   103381 tttctggtga cttaaagact tctgttttta gtccaattat aataaaggat tgtttatgcg
   103441 cgcagacgac aatttctaca actcagatgc tgccaggtac aaagagctca gccatatttc
   103501 cggtatatga ccttcgtaag ctgctcggtg cgcttgtcat ttcggaaggt agtgtcaagt
   103561 tcgacatata atgtctttga aggactatct gagacagtcc atttctaaag atttggaggt
   103621 gagacatcga gattctttaa agattagatt aggggagaga catccattga gtgtgcatca
   103681 gcatatgatc gccgctaggc agatcatcaa atcggacaat gcagaacaac agcatgtaat
   103741 atcttctttg agtggttttt tggataagca gaagagtttt ttaagagtgc aacaaaaagc
   103801 tttaaagcag ctagagaaat tggacgtcga cgaaataatt gatacggcag cggaagtgaa
   103861 agcagtcagt aatgatataa aagaaactct tataacaagc actgaattag aataattatg
   103921 gacaacggtg tggagacacc tcagggtcaa aaaactcagc cgataaattt accaccagtc
   103981 aggaaaaagt taagaaaaca tgagggactc ggaaaaggtg ttaaacgaaa actttttgcc
   104041 gaagatagct ctcccttaaa gaaacagatt tccgcctgca gtgatatgga aacactttct
   104101 tcgcctgtaa agtctgaatg cgagtcgcga agtgcttctc tcgatgaaag tttcggaaaa
   104161 tgtaaacacg aaattgcttg cgattgttct gcgatagagg aattgctttg tcacgagtcg
   104221 cttctagact cgccgatgaa actgtcgaat gcccacacca tcttcagctc aaacaaatgg
   104281 aaactggagc tagagaaaat tatagcttca aagcagattt ttctagacat gagtgagaat
   104341 gctgaacttg cggcctacgg cgaaactttg tgtaacctga gaattttcga aaagatcagc
   104401 tcgccgtttt tgtttgatgt gcaaagcgaa gagcgttcgt attcagtggt ctacgtccct
   104461 cacaacaaag aactctgtgg acagttttgt caacctgaga aaactatggc tcgagttctc
   104521 ggagtgggtg cttacgggaa ggtgtttgat ctagataaag tggccataaa gacggccaat
   104581 gaagatgaga gtgtcatttc ggctttcata gctggtgtca tccgtgcaaa atcaggagcc
   104641 gacttattat ctcacgagtg tgttattaat aacctattga tttcaaattc cgtttgtatg
   104701 agtcataaag tgtctttgtc acgtacttat gatattgatc tccataagtt cgaagattgg
   104761 gatgtcagga atgtaatgaa ttactacagt gtgttttgta agttagctga tgctgtaagg
   104821 tttctaaatc tgaaatgtag aattaatcat ttcgatatct cacctatgaa tatattttta
   104881 aatcataaaa aagagatcat ctttgatgcc gtgttggcgg attacagctt gtccgagatg
   104941 catcccaatt ataacggcac gtgtgctatt gctaaagagt atgacaaaaa tcttcaactt
   105001 gtgccaatta gtcgtaacaa attctgtgac atgtttaatc ctggatttcg accacttgtc
   105061 gccaatgcaa tgatattggt caatgtgtgc ggggcttttg atggtgaaaa taatcctctt
   105121 agacactgta acttggatct gtgtgctttt gcccaggttg tattatcgtg tgtgctaaga
   105181 atgacggata aacgtggatg ccgcgaagct cagttatact acgagaaaag gttgtttgcc
   105241 ttggctaacg aggcctgtcg attgaatcct ctcaaatatc catttgctta cagggatgct
   105301 tgctgtaaag tattggctga gcatgtagta ttactagggt tattgtttta ccgagacgtg
   105361 gttgagatat atgaaaaact atacgatttt ctagatgaga gaggggaatt tgggtcacga
   105421 gacctttttg aggcaacttt tttaaataat agtaaactta ccagacgtca gccaatcaga
   105481 gagggtctcg cgtctctaca gtcgtccgag tatggagaaa aacttttaca tgaccttaga
   105541 gagttgttct tgatcaattc tactgcggat ctggataaag atacatcatc tctctttcat
   105601 atgtgatata gtaatggatc ttgatcaaat atctgaaaca ctgagttctg tggccgaaga
   105661 agagccttta accatgtttt tacttgataa actgtatgca atacgggaaa agatcaagca
   105721 agttccattt tcaattgttc gcttgtgtca tgtttactgc atgctaataa aatataacgc
   105781 ttctaacaat aattgcattc tgggccgtaa acttattgag gaaatgcagc agtttttgtg
   105841 cggcacaaga gtggatggat cggaagacat ttctatggat ctgagtgaat tgtgcaagct
   105901 gtatgattac tgtccattat tgtgttctgc tctgtgtcgt gcgccttgtg tatctgtgaa
   105961 caagttattt aaaatcgtag agcgtgaaac tcgggggcag tcggaaaatc ccctctggca
   106021 cgcgttacgg aaatataccg tgacggcgac taagttgtat gacatctata cgacaagatg
   106081 ttttttagag tataaaggac agcagttttt tggggaagcg gtgatttatg gcgcgaaaca
   106141 tgagcgtgtt attagacacc tcgtagcgac cttttacgtt aaaagggaag ttaaggaaac
   106201 gttgggattg ctgcttgatc cttcttctgg agtttttggc gcgtctctag acgcgtgttt
   106261 tggaatttca ttcaatgagg atggattcct gatggttaag gaaaaagcgc tgatttttga
   106321 gattaaattc aaatataaat atttacggga taaagaagat cactttgttt ctgaactatt
   106381 aaaaaacccc acggagaaat ccttttcgga ttttatttta tctcatccgg tgcctgtcat
   106441 agagtttcga gaaagaggga agattccgtc atctagagaa tatttaatga cgtatgattt
   106501 tcaatatcgt cctcagagaa agttgcgtac ttgccccact ccagctattt tggcacctca
   106561 tatcaaacaa ctgctgtgtt tgaacgaaac acagaaatct acggtaatcg tttttgattg
   106621 taagagcgac ttgtgtgagc agaagctgtc tgtgtttcag aaggctgtgt ttactgtgaa
   106681 tgtattcgta aatccgaaac acaggtattt ttttcagagt ctgttacaac aatatgtaat
   106741 gactcagttt tatattaatg atcataataa tccagaatat atcgaaagta cggaagtgcc
   106801 ttctgttcac attgtgacgg ctttcttcag gagaagaaca gaggaagaaa ggagtttgca
   106861 tttggtgatt gatgagacag aatatataga agaagaaata cctttggcct tgattgtgac
   106921 tccggtagca ccgaatccgg aatttacttg ttgtgttata acagacatat gcaatctgtg
   106981 ggaaaataat atttgcaagc agaccagttt acaggtatgg gcgcaaagtg ctgtaaacca
   107041 gtatcttgcg gcatgtgtaa gaaaaccgaa aacaccttga ttgattacaa gggaaatcct
   107101 atattactag cgaatgaatt tactgtttta accgataccg aatcggaaga ggaagggatg
   107161 gcagatcttg aaaagccctt acttgaaaaa gtagttgcta agtgtgatac ggaagctgaa
   107221 aaaaaattgc cttgtaaatc aaaaaaatga tagacgacgc agatttacgg cacgctcgtt
   107281 tttttttatt ttttggctat ttgacaataa acatgattgt aataaagtgt cactcgtttt
   107341 catccattag gctcgagctt tcagtattaa ctagttgctt gtaccgacgc ttctttttaa
   107401 ctaggtagcg tacaagtcga caaattataa aaccgatcga aattatggcg atgaccgcta
   107461 aattgataat aagtcctgtg ctccactcgg attcaaagaa agtttcgtac tggagaatag
   107521 gaaaagatag gcctacggcg ccacaaaaca taccgacgta atagccaaac aagggtttaa
   107581 cgtagcgaac caggacagct tctattacta tactatatat gcaagccatg acaagaaagg
   107641 tattgatgga agagtaagca acggttatgg aacgtatgta gatactattt ccgacgccca
   107701 ggcaagtagt aatgccgaga aacattgtag agtaacctag catgagttcg gttagattga
   107761 taacaacggt cttgaattgt acggtcccct ttaggttagg atgaattttc tgaaaggcga
   107821 aaaatgactt atccgctgat tgaaattgcg ttatcagcgt aacgttaaag gtggtgaaac
   107881 acacgaagaa gatgcaatag gcaaatgcgc ctagggctac cagtctgaaa gacaaggcgg
   107941 tgacgaataa ttgaaatgta tccatgatta agatgaattg aaagcaggat gacgtgtccc
   108001 ccatccaggt aatatccctc gttgtttggt taacgttaga tgttttgtta gaggagaaca
   108061 cttttgcaca gcagacaatg taataaataa taatcaggag gaataacata gccattatca
   108121 gtacgtagca tataatctgc acggggttta tgtaaagttg atgcgtcatc tgatatattt
   108181 gattgttagc ggagagatta accgctttga ggtcattaat ttcaaagtag gcgcacggaa
   108241 atcctaaatt tggaaagttt atggctatca gatagaccgt gacgtttatg aatgacaagg
   108301 ctgcacagat tatagagacc agccagatcc gtaaattaat ggtgtctaca cgactggagg
   108361 ccataccagc tctgtgatgg agaacaggtt tcagaacgat actctgttct cagagtggtt
   108421 cggtcagagt ttgtccgatg taagatttcc ggacaatgtc accgtttatt ctcaagccga
   108481 ctcggcggtg agttttgaaa acgtcaggca gccgataaaa ctggttcgcg cagcgatggg
   108541 ttcaggaaaa acaacagcct tgattcattt tttgaaacag gtacccaggg aactatctgt
   108601 ccttttgatt tcttgccgta aaacgttcgc tgctgaaatt ttgcaccgtt ttactctcaa
   108661 tgggttgaag gattttgaat tatattgcga tattacggag cggcagataa acaacagaaa
   108721 agtcattgtc cagatagaaa gcttgcatcg tcttacagaa aattacgatg ttttaatatt
   108781 agatgaaatt atgtcgatta taaagcagtt ttattccaaa acgatgacaa aaaccaaaga
   108841 agttgattgt aagtttttat cgctgatcaa aaattccagt catgtaatag ccatggatgc
   108901 gacgctgact cggcatgtgg tggagttttt tgccgcgttc aagccagata ctcaaatcgc
   108961 cctcatcaga aatacatttg tgtccgcgat gttttccaat aggatcgctt acttttgtga
   109021 cacgtttttt ggtaaagagt tttctttttt tgcacgcttg gaagacaagc tacgatggga
   109081 taagaaattg tgtttgtttt gcagcaccgt gttggcagcg gaatacatgt atgatttgat
   109141 acggtctcgg tttccactca aaaaagttct cttgttgacg tctaaacaag ggaaatgctc
   109201 ttccatagaa tcgtggatac ggtatgacgt agtgatttat acgtccgtcg tgactgtcgg
   109261 tctcagtttc gaaccggttt atttcagctc tttgtttgtt tacattcagt tggccaaagg
   109321 agggccggac atggtttcag tatttcaatc cattggtcgt gtgaggcgag ttatcgatga
   109381 agatatatac atttacatga atcccgtatt aattagaagc tatgatcctt tggcacctat
   109441 tgccatacct ccgtgcagtg attggagtgt cgctgagcag tctatcatct cagagagttg
   109501 catcgacttc cgcggaaagt gcagcggagc gcataaatat aatttctgtt ccgtactgaa
   109561 gtctcttttt cggtacaggc attatatcga aaagactact attacaagtt tatctgatag
   109621 tttatttctg ctatgcagtc tgttatgtga gaattctatt aaggtggaca tcgttggaaa
   109681 tggattcccg atgcgcaaag aggtttttct gagtttcttg cagattctag ttgaggagtg
   109741 tcattttatc gaaaagaaga ttactttgcc gggtgacgac atgacgttcc aagagattat
   109801 aagtagcaga gaaactatca tgaacgggga tttttatgaa aacggtgatc agctattaca
   109861 taaggactat attaccgaca tgggaaagtt cagagcgact tttttatctc cgggcgttga
   109921 cattttcatc gcatcggaca ttgtatatga tctaaaaaat gaaagcaaac gctatgtttt
   109981 tgtgaacgtc tggttgcaaa aatgtgtgtc tgccggtgtg gaaagcacgg aaatcgaaag
   110041 agttttttgt gagcggatta agtgctatat gctgccgaag agttttctgt gcgacgagta
   110101 ctttgttcta ggtgacattt ctggggttta cgagtgggga atgttaatag atctggcctt
   110161 cctggcggaa atgatccgaa aagatttgaa actgaaatcg tgcacggata ctactactga
   110221 catttctgaa gatgatctcc ttttgtgtgc ggccaggagg tcaagtgaca tcttacaaat
   110281 aatgcaatta gtgtttacgg tgcatgtgca attttttcaa aaatacagtc tgcagactct
   110341 gcagcttttt aacaagttga gaggcatgcg gattgtgacg ggtgtgttct ctatagaaaa
   110401 attcagcatt tctatcctca ggcttttctt taaatgtgca tttaatatga ctctgtccgc
   110461 cagcagacct cggtacattc ccgggaaggc gtatcgcaat ctaacaaaaa atgatatgga
   110521 gaacatgcta gacaattggg agatttcgcg caccaatctt aagacttgca aagaactacg
   110581 taaagccctc accgaggcct cgagagcaag gcggaaacaa acaatttata aactgcaagg
   110641 ctcggatata agcctctccg ttagtgaagt tggagttttc gggcaacatg catctccggg
   110701 ggtgtgcgtg tcatcttagc ctttattgtg tgtacaatga ctgggagaat aagatctaca
   110761 gagtaccgat ttttcagtgt ctgtttttag aagcggagac tcgttcgtta aaaacgtttt
   110821 tgattagggg acagagccta gaccaagaat cgttaaatga gatagaagtt acaagaaaag
   110881 aaacaatgct ttgggacctt caggaacaaa gtaatatgat ggacaaaaaa atagcagcaa
   110941 tcagcaacct cattatgaat aacggagagc ttgttaggac actttcaaaa tttttcgtgc
   111001 ctctaaccgt tgttcttgga gatgacgggt tagagatttt ggaagcatac gtttgtggcg
   111061 aggaactcat gttgcctctg gacacggtac ctgttatctt acggtgtatc ggagactacg
   111121 cggccttgga cacgaagcat cttttgagta acgaatgtac acaggcttcc aaaaaaattc
   111181 gctttggata cagtgtgatg gactttcact tttcgctgac tgtgtctgac gtgaaaattt
   111241 gtttttcaca cacggacacc ggtgaggccg tatgtgaaaa aatgaaacaa attttttctt
   111301 tttctgtgtg tgctttcggc ggtgagcaag ttctcttagt gacgccaaaa aatgcttatg
   111361 ccttattgtt cgacgatgat ttgtgtttgc ttttactgca gagcgtgttt gctttcctgc
   111421 acgagaagat attcggagtt tataaacagg tattagttca gctttgtgaa tacatcggtc
   111481 ccgacttatg gccctttggg aatgaaagat cagtttcttt tataggatat ccaaatctgt
   111541 ggcttttgtc tgtatcggac ttagaaaggc gagttccgga tacaacttat atctgccgcg
   111601 aaattctttc attttgcggt ttggcgccta tcctgggacc tcgtggtaga cacgcggtcc
   111661 ccgtagtcag ggagctaagt attgaaatgc ctggaagtga aacttctttg cagcgtttca
   111721 ggttcaatag tcagtatgtt tcaagtgagt ccctgtgttt tcagacaggt cccgaggaca
   111781 cacatctatt ctttagtgac agtgatatgt atgtagtgac tttgccagat tgtctgaggc
   111841 tattattgaa gtccacggtt cctaaggcct ttttaccatg ttttgatgaa aacgccacgg
   111901 aaatcgatct gcttttaaaa tttatgtcaa ggctgcaaca cagatcgtac gctttattcg
   111961 atgcggtgat ctttatgtta gatgcttttg tttccgcttt tcagcgagca tgtaccctaa
   112021 tgggaatgcg atggctgtta gtgcgggact tacacatgtt ttatttaacc tgtgatggta
   112081 aagatacaca tgttgtcatg cctttactgc aaacggccgt agaaaactgt tgggaaaaaa
   112141 ctacggaaat caaacaaaga cctacatttc agtgtgcgga aatttcgcgc tgtggattta
   112201 tcgtctacgc cagatttttt ttgagcagtg ggttgtcaca atctaaagaa gcgcactgga
   112261 cagtaacggc gagtaaatat ttatctgcat gtattcggac caataagaca ggtctttgct
   112321 ttgccagtat aactgtttat tttcaggata tgatgtgtgt ttttatagct aataggtata
   112381 atgtttctta ttggatcgaa gagttcgatc ctaatgatta ttgtctggaa tatcatgaag
   112441 gacttctgga ctgcagtaga tatacggccg tgatgtctga agatggacag cttgtgagac
   112501 aagcacgtgg aattgcgttg actgacaaaa taaacttttc ttattacatt ctcgttacac
   112561 tgagagtgtt gaggagatgg gtggagagta aatttgaaga cgttgaacag acacagttta
   112621 ttaggtggga aaacaggatg ctctgtgaac acattcattt actgcatttg aattaacttt
   112681 atttctttac ataacataga aaaatgagac ttagctagat gtgtctccat tcttcgaata
   112741 aaaagtttgt gcgaattgtg ttgctagttg tatgacttgg agagaactgt cttgcagctg
   112801 tctagattct aatgataaat tgatgaaatt gtgactacgt tttgtgttaa aataaagttc
   112861 caaaacttct atatgcgtgt ttttcatttc attgtatagt ctaatcatca gaggcacctt
   112921 gtggaggatt tctgaggcgt gttcgttaaa aaaaatgtgt cttagtgtac aaaccaacgt
   112981 gtcacacgtg ttaaataata ttttcgttat cggagatagg gctggaaaga gaacgagctt
   113041 agcgattagt ttgtgtaggg tgctttgctt cagtggaaga ttttctaatg cgaacactag
   113101 tccgcaaagc ataaattctt ctggcgtatc aactttcata tggattagtc tgcgtttgaa
   113161 ctgaaaggga ttgagtcgca gttcttgcag tgtatcttcc gagtctagta ttatgatgcc
   113221 gatgaagcct tgaaatccca attctttttc gcagatggtc ttgtactcca ggccgttgat
   113281 catggttccg tcttccaagt ggaaccatat tccgtcatct cctactgtta tatttactaa
   113341 cggatgtcgt gcgagtgata tacatttatc aatcttgatc acctttagga tagttcggac
   113401 gtgtaagatg ttgaatacgt ctgaggtttc taattctttt aattttttca aggatttcat
   113461 tctccgggtt tggggagaaa atgttcgaat cgaaaatcgg ttcgctgttt tcggggtgcg
   113521 tttgggttaa attaaacact tctgatatct gatttagctc tcggacgtat acgagtctta
   113581 aataatgctt gattttgctg ctttcgtaga tggctaataa gatttcaccg agggatagaa
   113641 agagaaattc ttcgggaatc gattcgaggt tgtaaatgtt taagaatcgc cttaggaaag
   113701 gcacgatgag cagctcgatg ctatagttag agtatgtgat actttcttcc tgtccttgat
   113761 tattaacgtt ttttcttaac cggaaggttc gcatgtattc catttcccat agctggtcta
   113821 ttcgtttgtc ggcatattgc gtgtctggga tatactgtga aaaaaaactg ttcgcgactg
   113881 atcgggtgtc atctatggaa acgctagtga atgggagcct ttgaactatg tttagcgctc
   113941 gagataaaga gagattctcg aggtcatggt ccagattcgg gttatagcga tcacaatcgt
   114001 tattcgtctc gagcaaggag tgtagatcct tgattttcct ttcgaacatt tggtttgttg
   114061 ttttgagtgt ttcgatttca tccatctgtg tttgtatctg ctcctccatg cacttgatga
   114121 tttgtttttt gaacagatct cgaacgtctc tctctcctgt gtcgatcgca gagcgttttc
   114181 ggaactgtcc tcggttcaac atgagtttat tttggtctat tatagaggga gtgatttctt
   114241 gaataaatcc ttcaacgctg tccctaatgc ctattttaga tttgctgtcc gataagttga
   114301 gtaaaaattt gattaaactt tttttcgcgt cgctgctttt ctcttctttt tctatcatgt
   114361 ccattatctt tttgttggtt acatctgtct ttgctgtggt tagcaccttt atgggaaatg
   114421 tattcaataa ttggcacatt ttttgatgac gccgcagact attgtgtttt tttagttctg
   114481 gagaaaggtg ggcgaggggc gtagtcagca ttaagcgatt tctaataaca tatggggtgc
   114541 tgtacgtgaa aaacgctata gccttcttgt ttttaaaaca agaaatctgc tccgaatttc
   114601 ggtctcggaa aatcttaata ttgtgaaaat ccggaatgat cacggaagat agacccagta
   114661 aaacgggagt tacaatgttt tgtttatgcc gcactatgtc gtggattagt ttagatgaca
   114721 cttgttgtag gagattgtat aagttcgggg ccgtatgggt ggttctcatg aacggaacga
   114781 ttcctacagt acagatccag tctacatatc tgttatagtg actgttgtct atgctctgaa
   114841 gaataaaatt aattatatta gatatatcac ccaagatcac ctgtttaatc gcgtgggccc
   114901 atacgctaaa ataatcttga aatgacaatt ttttgttgtg gaacggaaat gacctcacat
   114961 gacgtttcca ttcatcgtgg atttgttgaa tggaaacgct gtttaaaagg gcttgcgcta
   115021 ctccataggc tatttgtttt ttcagtacgg cggaatctcg gagagcgttg tggattgtct
   115081 gacctttgaa aaaatttttg tgtccgtgta gcatttcaat aaaagtcatt atctgctccg
   115141 agggataaat catgtctatc tcttcgttgt tcggaggtag atacgataat aagtttttgc
   115201 ttaacatgtc ttcggctccc aaaatagagt tgattgtaga taaggtggct tcgttatcag
   115261 aaagacgctt ggaggggcgt ctgccggaag attggtttcg ccacatcatg gatcccgaaa
   115321 ccgagttcaa cagcgaattt gctgatgctc tgtgcatagg tattgatgaa ttcgctcaac
   115381 ctctgccttt tttgccgttt aaggccttgt tagtaaccgg tacggccggg gcggggaaaa
   115441 cgaacagcat tcagacctta gcggccaact tagattgcat cgttactgca acgacatcta
   115501 tcgccgctca gaatttgagc gttgttttaa atagaagtaa atccgcgcaa gttaaaacaa
   115561 tttttaagac ttttgggttt aatagttcac atgtatctat gagcgaacgt caaagttata
   115621 ttgcaaatga cgagaggtcg attcaaattc aacagaagca agacctgtcc atctattgga
   115681 atgttatctc cgacatagcg gatagggcgt tgggtgctgt cgcatgcaaa actaaagagt
   115741 tacctgattt gtgtgagagt agtgttatag ttatcgacga ggcgggtgta atattacgac
   115801 atattctgca cactgttgtt tttttttatt ggttttataa cgcgttgtat aaaacccctt
   115861 tgtatgagga cggaattgtt ccgtgtatcg tgtgtgtggg ttcgcccacg cagagtaatg
   115921 ctttggtgac ttcatttaat ccgctgactc aaaataagga cgtgaagaga ggaatagacg
   115981 tactttcggc cttgatttgc gacgacgtgc tgtctaaata ttgcgaagtc gataacaact
   116041 ggataatctt tgtaaacaac aaaaggtgtg cggatcatgc gttcggagat tttttaaagc
   116101 acatagaatt tggtttgccg ttgaagccgg agcttataga gtatgtcgat cagtttgtga
   116161 agcccgcttc gtacatcaga aatcccatga acgaaataga aacgacccgc ttgtttttat
   116221 cgcataacga ggtaaagaac tatttccgtt cactgcatga gcaggttgaa gttaccaaca
   116281 gaaataactt gtttgtgttt ccggtttatt ttctgataaa aaacaagact ttcgaggact
   116341 acaaaagtga aattggcaat ttctccttag aaattgaacc gtggtttaaa tctaatattc
   116401 atcggctgaa tacttattct cagttcgcgg atcaggattt atcgaaaacg gttcaattgg
   116461 aggagattgt tttggaagat gggtcggtgg aagagacttt gataacctgt catctgaaac
   116521 atatcagaaa cagttcaata ggtgtaacgt ccaagatcaa ggcttcgacc gtgggttttt
   116581 ccggaactta tgaaaaattt gtagaactgt tacagagcga tttatttatc gaaaaaacgt
   116641 catgtgatca gactatccac gcatattctt ttttatccgg tcttatgttc ggagggatgt
   116701 attctttttg ctgttcgaaa ttcaccaccc ctgaagtgtt aatggaaatc aaaaacataa
   116761 agatgcccag tattgaattc ttagaaagtg aaatgtcgag gatgtctccg gacgtacaaa
   116821 ccgtagagac agatgaaagg tatgatttcg gattagtcaa tgatgggtta tcggatgtgg
   116881 atctattaga gatcgatcct tgcggagatc cattttttac taggtatagt aagttgcctt
   116941 taactaattc tctgtcgttc gaggaaatca gtttgcttta tacgacgttt aaggatatct
   117001 ttatatctag gtttgctatt ctgcagaagc atacaaaagg gaagttcgga aagactctcc
   117061 tagttactta taacagaaac aacgtttcta gaaaacagtg cggtgagatc tattcccatt
   117121 taaagagttt ttatggtatg ctcacttacg ctatccctgc caataattat actctggagg
   117181 gctatacgaa tgataacgta gttcatttag gaacggataa acaattaccg cagatcttat
   117241 ataaaaaagg attacctaga ttagttataa aagatgaaat ggggttcatt tctgttttag
   117301 ataataacgt gtcgaaattt atcgacgtcg taaatggtca gagttttcat ctatgtacaa
   117361 cggtggatta cgccactgtt tctaaagttt ctatgaccat cacgaaaagt caagggcttt
   117421 ccatacaaaa ggtcgcaata gatttcggga gtgatccgaa aaatttaaaa ttgagttcta
   117481 tttatgttgg gatgtcacga gtaaccgacc cgaataattt aataatgaat gttaatcctt
   117541 taagactgaa ttatgagaat gataacttta ttgctccgca tattgtaaaa gcgttaaaga
   117601 acgaaaatac catgttaata ttttagggag gttttctatg agtatataaa aaactaaaac
   117661 atcagatgaa ttgtgcgtgt aattgttaaa atcccatacg gtcgaatgag ctcattcccg
   117721 tcggtccgtt tttctctgca aaacaaaggt accacgggga tttagtacag tatgtctcca
   117781 aacagagaag ggtatgaaac tttatgagga actggtgaga aataacttac ggttatgatt
   117841 tcggtttcgt cgcaaaattg actacagctg caggggtgtg gtctgagatg acatctgcaa
   117901 aaaacaaatg aaagtctccc ccggagtaca cgtatgtact ccggggggaa acctcaaaaa
   117961 tgcacaattt agcctattaa gcagccgcga actcgttaat agttactttg atgttaactc
   118021 aggtggtggc ttggatggtg tcctaagtat caatcgaagc tcctttattt tttgcactac
   118081 tgaagttatt ttaggtatcg gggtaagaat aagatgacga aaaaaatatg ctagatccgt
   118141 ccattaaatc ctagagttgt ttttagtaat aggttattta caaaagcctg catatgatcc
   118201 aatgtttctg tatgaatcca gataaacaaa aatccaggag taatgattgg aatcacaaaa
   118261 tgattagatg cttaacttac ttaataacta tacttaacta tacttataga ctaaacttaa
   118321 cttatcaact atacttaatt tttaggtcct tataatgtga actaaataat caactgtttt
   118381 gtgcccaacc ccccactact aaagcaatcg tctttgattt atgaaacaac gaggcccact
   118441 tcacgttatt acatagatca aggtctatct cttggcggtt tttgaattct ttcgagagcg
   118501 taacggtttc taggtttcag acacgtttat ccattcgccg ggtatcgatc ggatcatatt
   118561 agccgtgaat aatctctgac tttagatata acgtgtgaaa actagtaaaa aaggacaaga
   118621 gcagccgcct ttgccgtctt catgagcgtt aaacactcat gaggttcgta tcttacaaca
   118681 caatatgtga aatattgtga gcgaggttac cggtgtccaa gtcgtaatcc gaaaatcata
   118741 tattgaaact tgtaacaatg ttatgcagtt gtactcaaag tatatggtga tgaattgaac
   118801 atgtttttga tgttttcgat ggtattcgaa aataatttta gatatcctgt agtttttttc
   118861 tgatgacttt tctgatgact tttctgatga caatatagaa gatggcaaaa caacaagtta
   118921 ctggtagttc ttgatgttaa ataaaatgaa tcggagatat gacaagtaga gagaggtagg
   118981 tgatacgagt aaaatcgaag ggtgtttcca cacagacggg ggggaaattc tatgagaacc
   119041 acagccagaa gcaattgacg acaatagaga aaataagcaa gcatattcat ctgttataga
   119101 aagaaccagt gacctacgac tttccattca ggctagcatg gtgtgaacga gggttttttc
   119161 cgaaaaaact agatgactat ttctttaagc aagtgtaatt tttagcagtc caagttttta
   119221 tgcaacgcag attttaatga tgtgtccctc gataactata cgctggaaac taacttacat
   119281 cttagttgat aaacgatttt ctattaaaaa gactaaaggg attttttgat atatacaaaa
   119341 ttgtattgag ctcttggaag tgcgtagatg caaaataggt taaatcttac cttgaagtta
   119401 caacaggtca acgttagagt agacgtaaat tccatgtgtc gaatgcgctg taaacttttt
   119461 cacggaacat taaaaacacc gaatttgttc acgattatat aagcatgaat ttgcaatttt
   119521 aatagtccta taaagttttc atttcgatct aactacattt tagtatttat gttccataat
   119581 gtatcaaagt gtatacgttc aatctgtata agagtctgca tcaagcttca cgtgatttgt
   119641 agttcgcggt ttaatattcg ctgttttgcc gtgtatgaga cttacatagt ttgatcccta
   119701 atacttctga caggcgacga gcctttttat atgcatttta cgacaaagtc cacgcccttg
   119761 tcgctgacgc aatacgtaaa ggttttcggt ttggatgaga atgtggttaa ccgttaataa
   119821 aaaagtcgat acggaaaaaa gtcgaacggt atttttagat atcgggtcac atatcgattt
   119881 aatatatttt tatatcgtgt ttgttgtccg acttagatat gtcgtttcat gggaaaaata
   119941 aatcgtttta gttgcgtgct gtggtttttg gatcgcaaac gcttgagccc ggaagtgtga
   120001 ttcgtgcgca taaaaggacg ttggtaactg tgttcgctag ctcatttgtg ttagatgagc
   120061 ggcaaatgac tcatctttct gggatttata tgggaatatt ctggtaaaag tgcatgtatc
   120121 aattttagtc gtttttggat ttctgtaatg ttacgatttg ctatgtgtat tttcatgatg
   120181 tcgagcatgt ttattttatt ttttacacag ataagatgta tgctgaagaa cgtgcatatg
   120241 ggtcatttga cgatgttatg gaagtttatc aacagattgt taccgagtct attcagctga
   120301 aaaggcttca tttcggcagt ggctgtttaa ttgagttctt aggtgactct ggaacgtgtg
   120361 aaacattttg tggtggatgg atatcaatga tttgttggac atccgataca aattcaatgg
   120421 gttctctaac ggtggatatt gggatagatg atggaaaata taaaacgtac aatgctcggg
   120481 gttttttact gtgttcgaaa tcgatcacgt cgatttctca gaatactgag ggtagagata
   120541 ggattttgac tgtttcccaa gaaaacaaca aacttcaaat aacgtttgtt actctcacta
   120601 aagttttcaa agagcatgat atacgaaatc tgggcgatcc gaaatgtata gaaaagtttg
   120661 aaaaagaatg tcgagcttta gatagaaaaa aacacgatga tgaacacaga aaacgctcgg
   120721 ggaagcaaaa agaaaaaaga aaagtggagg acacggacaa aaaaaaagat gatgacagac
   120781 gaaaacaaga agaaagaaaa cgaaacgacg aagacaagca accggacaaa aaggaggaat
   120841 cggatggtaa atataaatgt atagttgttg taaattttta tttttcgtgt gtcacggtcg
   120901 tggacttttt tttaaatagt atctgttttg ttgcaatttc agaacttcct aaggagaaga
   120961 gacagaagta ccatgacatg aaacgtaatt tggaagaaca aagtcacgag gatggcataa
   121021 cactaacttc tacgacactc gtaaatggag cggttgaggg tgcgttaccg ccctgtattt
   121081 ctattgataa tcacgaagat caacaacatg atgaattaga caagcgcgct tatgcgcagg
   121141 tgggtggagt ttcgggttcg ccaaaaccta ggtcttcggg gtctttgttg tgcgtatcta
   121201 aagctgatct ttttatttta ggggacgaac cgagaaggtc tatccaatga agataattat
   121261 gggaattttc ggcttaataa gtctttagaa cagcttaggg ccaaacttgt tgcaagcagc
   121321 ggcgacattg tagaaagatc gcttttgaaa ttgaaagagt gtttggataa tgtaaaggat
   121381 aatttaataa aaaatgaatg tgctgatgtt actggtccaa gtaaatgttt aagtaaaaca
   121441 aaacatatcg agccaaagaa acagatagtg ttttctgatt gtgtcaggcc ggtacccgtg
   121501 tgtgagatta aaccgtttat cgatgtgcga ctatttgaaa cggcgcggag cccaagaaga
   121561 cttcgacaac ggaccaggac aatcgtcgga tcaacagatg gtgcgatcga gcaacagcgt
   121621 gttatttcgg gacaaaaccg aggcagagca cgaggacgtg gccgagggag agctcccagg
   121681 agacgaaatt ccaatataaa taattcaagg acacaaacta caattgttat agacgatagc
   121741 agcgaagccg aaaactttga aaatgagggg agttttaatg aagatttact ggcaaccaca
   121801 atattggaaa cactgtaaat tttattgttg tattgtaatt attaggtaaa ctgaataggt
   121861 tttattcgtt cagaatgttc caattgattg ggtctttccc gtgctccgta agaaataaat
   121921 ttgctcgcac gaaatgattg caaccaataa atggcatcct tgcagacttc actttgggcg
   121981 atggatgtgc actttctaag acgagatgtt tccgtgcgtc tattagataa gagagtttcc
   122041 gggcatggtt tccccacaat aagaaaacga gagagtccat ttctaccgat agtttgctga
   122101 taatcttata gctcagtgtt tgccagccaa atgcctcgtg agacattggt aatccatgaa
   122161 ctacagtgaa tatcgagttt agcaatagga ctccttcact acaccaggag tttaaacagc
   122221 cgttgtcagg gggggaaaaa ttcggcacgc ttctttccag ttctttaaat atattcttta
   122281 gagattctgg aatcgagcac tctttcactg taccgaaggc caagccgcaa cctctgccgt
   122341 cgggatacgg atcttgtccc aaaatcacaa cttttacatt gtcgggtttg cataaaaaac
   122401 tccaagcgtg gacgttatcc gaagaggggt ggaccattag atgagcccta tcgttgtcca
   122461 ccaatttata tacatgttta aggtgtgtaa tttctaactt ggagagttgc aggaaactca
   122521 accagtctct gtttatgccg aagagtgaat gctgatcatc tattgaaagg ttttcacagt
   122581 ttttttcttc atcctgaacg tgatctaaca tccactgtag tagggccatg gtcggggaat
   122641 gaaatgcagt ggattaaatt ccctaggagg attttatgtg aatgggacgt gatgtcatag
   122701 ccaattatgt gtttctaatc agaattgtag ggcgggaact tcggaaaggt agtttagaat
   122761 tgtaggtttc catatgtttt agcaggtcga gctctactcc ggttttcaag tggaaatact
   122821 ttaaacaatt caaaatcgta tcaaaaagag tcaaagagtt aaaagggaac ctaataattt
   122881 ttgtgacgcc tttagcagga ttctccaagt ataataaaaa accaatgttg ctgtaaaaac
   122941 tgtctgtgtt ttctgaaatg ttaaactcga gacccgcaat gttatcaaca aaaaagttat
   123001 tgacgtacgt aattttttcg ggcgaatatt ttctacagtt atctctgatg caggttgtta
   123061 ttccgacgga aggtgaacat gtctggaagc cattgaaaaa gtttagccag ttgtcccgag
   123121 attctgggtc ccttattagc gcaaacaatg tgcgtagttg ttctgggtta tcctgtagga
   123181 gtaagaagtc gctgagaaat tcatcggtta ccattatacg gctaaaaggc tttttttttg
   123241 tcgggggttg tagcagtatt gacataacgt cttcattata tgccggaggc tggtagattg
   123301 gttctagtaa tagaggcact tcggatttcg tgcagtttat tacagctgcg atacagtcgt
   123361 caagtttttc aaaatagaaa gaattatggt tgaaaagagg tattgctttt gagaaggtta
   123421 gtaatatgag tgacattaca aatagtaaaa gttccatggt tattttttta tttggaaaag
   123481 ttaacacgac gggaacaaca tcttatatat agtagggaaa aagacttgtc gaaatgtcca
   123541 ttcggctttt tattggtttt ttatacggca tatattggta tggctatcgg atttatatgt
   123601 agttcccccg atgcggagct gttttccgaa aaatcacgta tgtcgtcttc tgtcttgtta
   123661 ggatgtttgt tgtgttgcat ggattggtcc gctgccgtac ctgggaaaac agagcctttt
   123721 agaaaacttt ttgatgcaat catgattaaa aagctaaaaa gttgttctgc tgcttacccg
   123781 tctgatttgg agcagggctc gatgtgtgat atggcagatg catcgccgac aagtcttgaa
   123841 ttaggattgt cgaaattaga caaagaatca tgaaagtatt cgaagacatt aatactggtt
   123901 ttctttttcg ttacgacgaa caatatagaa gacgcaaaga gaccaattta gattcgagcc
   123961 aaaaaagttt atttagtcag tttaatagtt tgccataatc atcccaataa atatatttat
   124021 tgaaagagtt gtatatggtg atgtgttctt gaaggagcat cggttgtgtt agctttgcga
   124081 tattcaaagt aatctcgttg ggatagcaga tcgcaaaatt gatacaaacg tgagcggcgc
   124141 ataataaatc cttttccgtt ggcgcgttta tcatgagaga gcaaatgccg acaagctttt
   124201 tttttgaggc gtttaccggt ataggagtta cagcgttttt tcggagtgcg tccgtttgtg
   124261 ggacggtccc tctgaaaaac tgattgattg caatagcgac taccggttca tggtgaaccg
   124321 attcagaaat tatctgctcg cccacgttaa taaccatgtt gccgatggac atcaattttt
   124381 cttgcatggc gtttattaag atcttatttc gggaataaac ctgtatttgc acaattgaag
   124441 cgttgtagca gcggaataat ctgtaaattt ctgacataaa atttttaggt gagcacgggg
   124501 agtaaggtgg agatgtttcg taagattgaa aaattttgaa agcgttgact gtattccgat
   124561 cttgcctttg gcattccgta gacctgacaa tttccttttt ctccgttgtc gatgtattta
   124621 caggcatttt gaatgacagg tcggcgagag gtttgtccgt aaatacagta agacgattaa
   124681 tttctttttc ttggcgaaac acggcgtttg agattttccg tagtttggaa taggcgtaga
   124741 tctcgttatt tcgatatttt tccttattaa attttatatc gtatggggtg tgctggggaa
   124801 agactcttgc agtcgcataa tcgacgggtt tttcggttgg ggtggtttgc ggagatagat
   124861 tgttttgtaa tcgattattt cgtatagtcg ttttagcgga tagatttttt ttccgttcta
   124921 cgaactgttt cgttgttttt ctagttcggc gagatttgac ggtctgtctt gttttagagg
   124981 tgtttttatt tcctctgtct ttcatctctt ctgaacttaa gctatataaa ttttaacttt
   125041 taaatgcaac gatacacacc gaaatcagta gcactataac tgatatcaat atcagaatta
   125101 atggtacggt ccaggtaaat acggtttcgt cagaatttga actttttacc ccttctttac
   125161 tgtattcgtc gtgattctgc acagtgtgtt cgccggaagt tacaagagcg ctagcctttt
   125221 ggttggtaaa ccaactcgac gctagacatg agacggtttt cccgacaaat tccagcttcg
   125281 ttcgtctttt gaaagtaaag ttcacactaa cggttgacga tccgttctca ttctgtctaa
   125341 ctattggtat gtctctctta tatacttctc caagaaattt aataaccaca tttggttttg
   125401 gataagacgt cacggtacac gtaacgtcta aaaaattgtc taagtaacga aagtacaaaa
   125461 cgacgatggg tttcataaag agttttaagc aactagtcgc agacgttttc tcgttatcta
   125521 ctgtgaatgt acaggttaaa catgtcgcgt catatgctga tttggcttta attttcaaca
   125581 gagatgtagt tctattgtgt tttatgtgga aatataattt actgtccacg gcgagattgt
   125641 tgatcttatt tagttcgtgt ataaggacgt agccatcgtc agtgaacgat aagttgtcca
   125701 tgttttgtac ctcatgattc gatataagtc ggtttttatt gtaccacgag acgcttcgga
   125761 tgtttgtggt tgtttcgagg cgacaatgga aagtgacaat tgaccctatt tcgtatatta
   125821 aagaaggact cgtctccggg tggagtacaa aatgtgcact tatgatatat agaagcggca
   125881 ataaccgaag catcagagaa ctcatagtgt acgcttgtgt caaatagcag tttctatgcc
   125941 aaatagcggt ttctgatata tatataagtc acgcttaaaa taaaaaaact caaggatttc
   126001 cgttatactg ttttattttt ttttaaaaaa aagttgggag ttaacatttt gaaagtgtac
   126061 taaatttcga tttaaactct ttgctgatag gattatagat ggagatagga ttgtcaccgt
   126121 cgatgattga acacacccga aggacaattt ctttagggtt atctttggca tacttattgc
   126181 atgttttaac agctcctaca aagtcgatgg gcgtagcggc gtaaattatc atagtcttta
   126241 cgtccgaatg tctcgtaaat agatcatgtg ttgtgttgtt ttcaaattta tcccataatt
   126301 cttgcggtcc ttgtttttgt agttggataa atcgtttaat ttcatctttg tcataatact
   126361 taggcggtgc atgattcatt ttaaatgcct ctgaaacagt gatgttgggt cgaatcatta
   126421 attctttttg cattatcttt atgatttgag ctactttttt tgatcttgta aagtacataa
   126481 tgatggctgc gttgttagag agcccattac agcagatgtc gtatacagct tcttttagat
   126541 ttttttcatt gcaaggtttt ttggggatct gtttgtattc aaatgctctc atagtatttc
   126601 taaatagttt ttgaaaatct tttgtagcca ccctcccgcg gtgaatttta aatttttctg
   126661 atacttttct ttcttttagt ctaacataat ctctataaca caaatcgtca ggttcactta
   126721 cttcagactc tgttttctgc gctccggata ttcttttctt gcagaaattt tttatgctgg
   126781 aatctgaatc atcatcgcgg gggcgttttt ttttgcattt ttttgtgttg tgtaatctga
   126841 cattttgttt tccctgtagg tgagaagtcg tgatattagg tgcctttttt tgttcttcat
   126901 caatggcgtt ttcggaatga ttggattgtt catgtgtgtt aaatggacta gaattgtgta
   126961 ggggaaattt ttcacctgct tccggggagt ttttaaacac atctgcatgt ctattcgatt
   127021 cgtaatctga agacatgttt gtagttttgt gttttgaatc tgatttagat tttatttgtt
   127081 tattgtcttt atattgagtt ttgcggcatg tttttaatgt ggatttggaa catgataaag
   127141 aagctgatga tgatgatgat gatgatgatg atctagttct ggaagactga tagtaaaatg
   127201 gtgtaaactt ctcttttccg gttactatat gtgaattaga tctgcaattt tcttcaatac
   127261 tggaagagat gcttgatgat ccagatttgt gtttttttct tcttacaacg gtcagtgaat
   127321 ctggtgaatt tcgacagtga gatttgcatc tagacataga actttctgaa tcggtgtcat
   127381 tggtggattc tgattttttt ctgttggttc ttatatgagg tctgaatcgg gggttgtaaa
   127441 attgatcatt gtgattaaag cactggagtc gagctgcagt atttttgtag aaatttagat
   127501 cttctccaca tcgaaatttt atttctgata tttcaaattt tgtattaatt gaggtgtcat
   127561 gtggaggcgt ttgtctttta ttagaatcgc aataaatctg cctcagctcc ctgctggaag
   127621 ccctgctgga ggctctgctg gaggcttttc ttgaggcttt acttgaggcc ctgctagaat
   127681 ccctactgga ggctctgctg gaggctctgc tagaatccct gctggaggct ctgcttgagg
   127741 ctctgcttga ggccctgcta gaattcctac tggaggctct gctggaggct tcgcttgagg
   127801 ctttaccgga ggctttgctt gaggccctgc tggaagccct gctggaggct ctgctggagg
   127861 cttttcttga ggctttactt gaggccctgc tagaatccct gctggaggct ctgctggagg
   127921 ccctgctaga atccctgcta gaatccctgc tggaggctct gctagaatcc ctgctggagg
   127981 ctctgctgga ggctttgctt gaggccctgc tagaatccct gctggaggct ctgctggagg
   128041 ctctgctgga ggctctgctg gaggctttgc ttgaggccct gctggaggct ctactggagg
   128101 ctctgctaga atccctgctg gaggctctgc tggaggctct gctagaatcc ctgctggagg
   128161 ctctgctgga ggctctgctt gatgccctgc tagaatccct gctggaggct ctgcttgagg
   128221 ctctgctggg agccctttta gaagccatgg tgcaactttt actcagatgt ttatcagagt
   128281 ttttgccaca agttcggtta ggatctttag attcattttt ggtggaattg cagttaggtt
   128341 tcctgtcagt acactcatca ctgttagaag tgctattcgt gatgcttttg ttactgttgg
   128401 atttgttaaa agcagtagga tttaaattac tccgaatagg tgaattgtct gttaaatttt
   128461 tgtcggcgct tgcagtgtgg tttttagcac tgtttttgtc cataattgaa ggatttttta
   128521 acttgcaata tggagaaggt gattggataa tagtttttac cggagatttg tattgacctt
   128581 cttcatcaga gctactggaa taatggtgtg tttttgattt tggtgatgta gatgtggctt
   128641 tccctgaaac attcttaacg gatacttcct taaagttttg gtgtccgttg gagtttgtag
   128701 tatttttttt agatgttgta cgtccaggag aatgtttcat tttaggataa ttgtctttgg
   128761 agtcatgatg ttttttgtaa gaattatctt tggtcggggc tcttggagta tgttttgata
   128821 tgggaactgt gtcttgtaga gaagtttttg atcggtgtag attttgttgt atttggttga
   128881 attctggtgt cgaatagaat ttatctgtat ggtccgcaaa gtctatggcg ggttcaggtg
   128941 tcaacggaag aggagataat aggggattta attttgaaaa atctctagct ttagtaacgg
   129001 ctttatcttc attctcatta gattttctct ccttaagatc agaacgtgat gaggcatggt
   129061 tttcatcatg tttgtttgtt tgagaactgc gttctttttt cttctggact gatctacaac
   129121 ggatatgtgc ttttttgtac ttctgaatat ccacgtcacg atttgagcca ttggctgtta
   129181 aggcttcctt cggtaacgga ataacgtcag tgtcatatat ttttttaata atatccattt
   129241 tgtaggaact aggtctgtat gataaactga ttacgtcagg cgttaaaact tgattttctg
   129301 tggatgtttc gttatcctta gtagcctcat gttttttagt ttttgtagtt tctggtattg
   129361 tctgtgcttt tgttggatga ttgtaattgt cggattgtac gtgtgtggag tctgttgaga
   129421 atgccatgct atagtcatag gattcaaaat tgaacttgtt tgttagttgt gtaaaatctt
   129481 tatagttatt catacggggg tctggattct gttgttcgta gtttggatac gtgtaatgtt
   129541 catatggtaa atccgcggat ctgtctgagc aatcgtatga tctgtggcct cttccgcgtc
   129601 tgttataagt tctggtaaaa catcttttgt atggctgttg atactttgag tttggattgt
   129661 agtaattata ttttccattt cctcctctgg gcctatacgg atgatgtcta aagttatagt
   129721 catatcctct attggtattt ctagattctc tgtaggaact ctctatatct ctgtatggat
   129781 catgataagg ttgatacggc aacgaggtga aattgttctg tagatttgca ttttggttat
   129841 gtgacgtgta catgggctgt aggagttgat tcggtagttc cgaagcaaag cgcacctggg
   129901 tcgaaccgct ttcgtttgat tgtagattgg aagcagagga tgtgcattgt ctgtgggtct
   129961 gagctactat ccgtggatcc tggatagttt ttgaaaatat tctggattct tgagaatata
   130021 taggatcttg atgcgtatta tcactcaacg gttgtgtgtg tgtgatgtcc gcatcacagt
   130081 atagtccgga taatttcatg gcgctttgaa tgacgtcgtt atcatttcct tgtttgcatt
   130141 tttgttctgg aaaacatgtt tataaaattg aagcttaata gacagtattt gcttaatgta
   130201 tttaataaat tacggataat cattttcatt atgatacagt ccgtgcagag gatgatgttc
   130261 ataccgattg tgcgtggtgt gcaaatgaag acgttatagt ttgtagtaaa aattcactaa
   130321 atcgaattac taacaatggg ggggattatt tatataacaa tagtatatta ggtgtcatat
   130381 attaatttca tttaaaacta ggatggacaa tgacataagt tatatatgaa acccggtgaa
   130441 gttaatgaca attgaattgg atggtctatt aatttatttt taaatatttg cattagatta
   130501 tattataata aaattgtttt aatattaaaa atttaaatga ttgatgtatt cattattgac
   130561 atgcagtaaa tccagtatat tgggtaaaag tgagatttat tagtcggggg gcgggcgtat
   130621 gtataatatt catgttttta atatatggta tttatcaatt atctacttgt ctaattgtgt
   130681 tggttgtgtg caagaaaccc gtggatatat taacgaataa ttgaaattga attgagtgaa
   130741 gtttgtgact atcaaagggt taatatgcat aatcaaataa atactgatgc taccacgggg
   130801 atggatataa tttgataatt agaatacaat tatttattat gtattatgga gataacataa
   130861 tttaaagttt atagtagact agtttcatta tgtttctaat gtgatagcgc cctctgctgt
   130921 tgaggtaaat tatatgatat tgagcatttt aagtatagta gtttgaatat gtttctgatg
   130981 tgatagcacc ctccgttgtt caggtgaaag attaatagtg gtaaatagac atttttaaag
   131041 tactttaaac ctaataattt gatctattgt gctttttgtg tatgtctcta tgtatgtctc
   131101 tgtgtctgtg cacgtgtctg tgcacgtgtc tgtgcgtgtg tctgtgcgtg tgtctgtgtg
   131161 tgtgtctgtg cgtgtgtctg tgcacgtatc tgtgcgtgtg tctgtgtctg tgcgtgtgtc
   131221 tgtgcgtgtg tctgtgtctg tgcgtgtgtc tgtgcgcgtg tctgtgtctg tgcacgtgtc
   131281 tgtgcgcgtg tctgtgcgcg tgtctgtgtc tgtgcgcgtg tctgtctgtg cacgtgtctg
   131341 tgcgcgtgtc tgtgtctgtg cgcgtgtctg tgtctgtgcg cgtgtctgtg tctgtgcgcg
   131401 tgtctgtgtc tgtgcgcgtg tctgtgcgcg tgtctgtgta tgtgcgtgtg tctgtgtatg
   131461 tgcatgtctc tgtgtatgtg catgtctctg tgtatgtgca tgtctctgtg tatgtgcatg
   131521 tctctgtgta tgtgcatgtc tctgtgtatg tgcatgtctc tgtgtatgtg catgtctctg
   131581 tgtatgtgca tgtctctgtg tatgtgtatg tgtatgtctc tgtgtatgtg tatgtctctg
   131641 tgtatgtgta tgtctctgtg tatgtgtatg tctctgtgta tgtgtatgtc tctgtgtatg
   131701 tgtatgtctc tgtgtatgtg tatgtctctg tgtatgtgta tgtctctgtg tatgtgtatg
   131761 tctctgtgta tgtgtatgtc tctgtgtatg tgtatgtgta tgtgtatgtg tatgtgtatg
   131821 tgtatgtgta tgtgtatgtg tatgtgtatg tgtatgtctc tgtgtatgtg tatgtctctg
   131881 tgtatgtctc tgtgtatgtc tctgtgtatg tgtatgtgta tgtgtatgtc tctgtgtatg
   131941 tctctgtgta tgtctctgtg tatgtgtatg tgtatgtgta tgtctcttgt gtatgtctct
   132001 gtgtatgtgt atgtgtatgt gtatgtgtat gtgtatgtgt atgtgtatgt gtatgtctct
   132061 gtgtatgtct ctgtgtatgt gtatgtgtat gtgtatgtgt atgtgtatgt gtatatgtat
   132121 gtgtatgtgt atatgtatat gtatgtgtat gtgtatgtgt atgtgtatgt gtatgtgtat
   132181 gtgtatgtgt atgtgtatgt gtatgtgtat gtgtatgtgt atgtgtatgt gtatgtgtat
   132241 gtgtatgtgt atgtgtatgt gtatgtgtat gtgtatgtgt atgtgtatgt gtatgtgtat
   132301 gtgtatgtgt ataatagagg gaaacaaata gagagataga ggatagagag atagatatgg
   132361 gggggggata taaatatggt aattttcaat ctgtgtttcc aaaattggga atcatgtgta
   132421 gcatcttacc ttcaaagtga ttccagttaa taagatgttg caataaaaaa tggatttggt
   132481 attttagata tatactttca agtgtttggt gtgacattca aagtctaatg gttgaaaatg
   132541 tttttcataa atggtagcta ttatgtgaat gttaagcaaa aacagattaa atatacctga
   132601 aagaaaaata ttttgtagag tgttatgatc tagctatagc taatgtaata tattttttaa
   132661 cagtactatg atttatagaa ttaagatgtc tcgggggcat tagtcttaat caactggttt
   132721 agtttgggga agtgaaagta aaaatctgaa tacttgacat ctgtataagg tttttcaaga
   132781 atacaattgt ttatagtatc acgtctctaa gaaagctgga attaacttat ggaaatatta
   132841 tatgatgact tataagtcag ttgatgtaca tgtcttggaa ttaaaaagag aaagcaatgt
   132901 ctatattact ttttattatt tgtaaggtga tattgaaaat aaattcattt gaggaatcac
   132961 gtgtttgttg atgtattaca taatacaaaa agttacattt gcttatgtaa tttctaatct
   133021 atagcaacaa aaagagttac acaatatggg gaaagtctat attttacaac agtataagca
   133081 tatttacata atacacatct gtatgctaat gattgctaat caatttacat ctaggtttca
   133141 tctagctaat agatttgagc attttctacg aaaggatcat aatcagaagg gtagccatct
   133201 aatttaaagg cctctgtacc atcactgttg caatcactta tattggtaca tttttcatta
   133261 gaattacttg taccttcagt gcatctgttt tcatcatttt gacttgttgt gtcattgata
   133321 atatttagta tggaggaatt atttcctgtt accggtgggt caaacacttg agttgcggtt
   133381 gttgcaaaag tttgggaatt tgtcatattt aaatcgtcct cacatgtagt aggggtgaca
   133441 acattatatt tattgcaaag atcctggcaa tgtttggtta tgccctgttt aatgatatca
   133501 tttagatcca taaaattatc catcaccata tctatgataa gtttcttagt tggtattatg
   133561 tctcccgagt ctattttgct attctgtatt ttattataaa tatatgagac attgttctta
   133621 tcatagtctt catcatccgt tttgatgggg acaaagtgat tcataaagca gtgtttggct
   133681 tctgtcccat cactgtcatc ttttgcatcc acattttcag aattgtgaat aggacaattg
   133741 tctacttggt gagttttctt catataccaa atccaatttt ttttgggaat aaatttggat
   133801 ttgataccac cggtaccctg cattgacctt attgggatgg taaacactgg agttggaaaa
   133861 ccataacttg gacaatgacc attattggta acttcatcat aatcactcaa atgtaactgt
   133921 ttatgttcag atgtacagtc atttgactcg ctgctcgatt cagaatctga ttctgattta
   133981 atagctttta ttaagattga gttaccaata atattgtcac catcctcttc atcttcactc
   134041 tctgaactta taacaattac gtctgcagcc ttaggtaact gatctgtctt aatcttttta
   134101 tttttgggtg atttacttga aacatgtttc cttttagcta ccctcttttt aggtttgctt
   134161 cccggagtca tagacttagg tttgacattt ttcttagaag gggtgacctc tggtggtgaa
   134221 catatagaat tgctaaatgg tgtattctca tcagtgctat tcatatgaat gttattagtt
   134281 ctcgcagctg aatcagagtt tgcaatgtaa tcaatttcat cattgttatc gctttcactc
   134341 tcatagggtg ccgagtgatc agtttcataa ccaaacatca tcatttctga tattaaagtg
   134401 ttgccatagg aaccatcttg ttctgtccct tcaactactg aatcgcattg agtgtcaagt
   134461 agtctttcta gcaacatgtt tttacaactc tggaggccgc tgatggagtt caagttatca
   134521 gggccgccca gatctgtcac tgaggctgta cctacacagt tagggtttgt ttgttcgtcc
   134581 cctgactgtc tgctgttttc agtgaatgtt cctacatatt tggatttccc tggcacttct
   134641 ggagaaggag tgcatggata cattttattg tcatcatctt catggataga ttcgatagaa
   134701 gattcctctg aatatcttcc atggtcatca aaatcagcta agtctaatat cattgagtct
   134761 gatgggtctg tgtttccatc acagatggaa gactgtctat ttttattcat attaatgtag
   134821 ccgtccatta tttgaagggg agttaaaggt ttaattaaac cagtatcatc ataatctgat
   134881 tctaagcatt cacatgcctg ggtaatcata ttcagcatgg taactttaaa tccccgtctc
   134941 agaagtttga ggtgttgcca tgaaaattca ttgctgcata taacaatact ctggagaata
   135001 gtattggcaa gatttttggc ggcagtaatt aaatttttac aattcacatt aagtttaagg
   135061 aatgctttat cacaaccatc catgaagatt tgattcatct gctttatagc aaatgtctgt
   135121 aaaatttgca tatttttagc atttgtttct actatctcat ttttaccttc cagtaatgtc
   135181 tgtttaagtg tatttatttt ttcacaaaag tccttactgg agatgtcagg attggacatc
   135241 tctttgttgt gtgccatcat catcaacatg gtggcgccct ggttaagttt ctgacaatct
   135301 aatgtcacag tagctttaga aaaaatgtct ttgacggcct taataatgtc attgttcata
   135361 ttagctctca aatccaggag caagtttctg gattctgatg ccaccttttt cactaaccca
   135421 tcgaatttat cacatgcaaa aacaatgaat ctaggttcgc accaattaaa aaaatccaac
   135481 tcttttccat gcaacatttt tgaataagat tcaacatatt tagttgaagc actacttaat
   135541 aaattaatgt ttatcaactg tgataattgt tctaatccta gtcctatgaa catggattgt
   135601 tgctgcgtta ataagccagc gcacttaatt aatttgtctt ccatgtcaga ctgttcctgt
   135661 ttcatggcag ccttcactga tgcaccaata ctttggatgc aattcccagc ggactgagct
   135721 aggatgtaaa agaagatatt ctgagtatgt tatatgtcac atgtttaaaa ctatgttttt
   135781 tcttgttttc tatcttggga catataatat aattcatgta cttaccagct aaagttttca
   135841 actctccatc tgatccttct tctacattat tggactctat gttgttggaa gactctggta
   135901 taataagacc aaagctttca aggcctggaa taatcaggtc atcgaaggat gtatcacaca
   135961 tgagactctc ttccaatatt tctttgatag attcttccat cattggatcg ggacggtagc
   136021 tgtaagtata aatatttttt aagtacttag aaaaattccc aaataatctt aaataagata
   136081 gatctaataa tgactaatca tacttactct tgcatacgtt catcattgga tcccatgttg
   136141 tttccagagg gttttgctgg ctccattgta tattaagatg caaattgaga caccgcctac
   136201 tgtgctgata gccaatgaaa aaatatctcc cgtcagcaca tataatacta tataaggaca
   136261 ttaccaccac ctctttcttt gcagagattc tctgcttgca catctgtaac actgaccata
   136321 atggggaaaa aatcatctac tggaactgga aaaactaatc taaagatact ggcatgtcta
   136381 ctattgatat ttctaatggc aacaatattt ttgctaatac tggaaattat atcgggccaa
   136441 agatattcca atgatgattc cgaaggtgtg actgcggcgc tgaagcatgt aagcacacct
   136501 actaccaact gcactgaaac cactactcct ggttagtgaa ggatatgtct tttttatttt
   136561 aatgtattga ttatatattt gcatacattc cttaagaatg aaaaaaaaaa tatcacggat
   136621 ggtttgtttt tagattccgt aacgagccaa gccatggaaa acaaagaatc aatgaaaaaa
   136681 aatgaagggg aacctccagt ttggattcag gctttaacta caacattatc aattatccta
   136741 ttggtttgca taataatggc atgcattata tgttcccgga ccacggaaga agagaagagc
   136801 gaaatgcaat cttctgcttc ttcagtagag actttacagt ctttaaatga ggctattttt
   136861 ccgaaaggtg aaatgaatgt gtaatgtctg tatttttctt tgcagagatg tatggagagc
   136921 ttatattggg ggaaaatacc tgactgttct gcctatattc gaatgttgaa gtatgtacaa
   136981 tataatttct taccttttaa gagtgattca aggtggaggt ttctttggag atgattccaa
   137041 gtggtggttt tgggcgcaat caatcttctg ggtgggaaga aaatccagca atgtaataat
   137101 tgatgggatg caatcgatgt gacaaatctg taagattaaa tgtgaacatt ataaattatt
   137161 ttgtgattaa caaattacaa tcatgtgcat gaaaatatca ttaaattgtt ttacaaattt
   137221 taaatgcaat ttaaaagaat ttttgtagca atcttaaata ttaatcgtta caaaattgac
   137281 ttaccagact gcaacgatat aagaaagaat gtctgtgatg agaatgttct ccggagccac
   137341 ttcttgagaa tagtggcact gaactggctg taacttctgc ttatatacaa ttctgtagcg
   137401 ggtgtgatgt acaggaaaat gacgaagatg aaggaaccaa tcgctgcata acgttaaacc
   137461 gcaagtgcag aaatacaccc cttttagaca aatatggaat tgaaattagt taatgcttgc
   137521 aaaaatttag ggttttgtta tattttacaa aaacaggaat ttgtggtctg gattttttga
   137581 ggttttttat aataaacaac attttactga taaattgtca tgttttttct aagaacatct
   137641 gttacacatc ataagacatg tggttttggt gttagcgttt ctcaataaat aaatgactca
   137701 gtcagaggaa aatgttgcaa tcgcggtccc cactaacctt taattttatg agaaaaacag
   137761 gaactgcggt tgccccgtta gcaaatttta gggttcttgt tagcttgggc aggaaagacc
   137821 ccaaccgcga tacccactga cctttaattt tccgagaaaa acaggaactg cggttgccgc
   137881 gttagcagat tttagagttc tcgtttgcct gggcaggaaa tattttccga gaaaaacagg
   137941 aactgcggtt gccgcgttag cagatgttag agttctcgtt cgcctgggca ggaaacacct
   138001 caaccgcggt acccactgac ctttattttt ctgagaagaa caggaactgc ggttgccgcg
   138061 ttagcagatg ttagagttct cgttcgcctg ggtaggaaac acctcaaccg cggtacccac
   138121 tgacctttaa ttttccgaga aaaacagaaa ctgcggttgc cgcgttagca gcttttagag
   138181 ttctcgttcg cctgtgcagg aaagacccca accgcggtac ccactgatct ttatctttat
   138241 gaagaaaaac aggaactgcg gttgccgcgt tagcagcttt tagagttctc gttcgcctgt
   138301 gcaggaaaga ccccaaaccg cggtacccac tgacttttag ttttccgaga aaaacagaaa
   138361 ctgcggttgc cgcgttagca gcttttagag ttttcgttcg cctgtgcagg aaagacccca
   138421 aaccgcggta cccactgact tttaattttc cgagaaaaac agaaactgcg gttgccgcgt
   138481 tagcagcttt tagagttctc gttcgcctgt gcaggaaaga cccccaaacc gcggtaccca
   138541 ctgactttta attttccgag aaaaacagaa actgcggttg ccgcgttagc agcttttaga
   138601 gttctcgttc gcctgtgcag gaaagacccc caaaccgcga tacccactga cctttatttt
   138661 tccgagaaaa acaggaactg cggttgccgc gttagcagct tttagagttc tcgttcgcct
   138721 gtgcaggaaa gaccccaacc gcggtaccca ctgatcttta tctttatgaa gaaaaacagg
   138781 aactgcggtt gccgcgttag cagcttttag agttctcgtt cgcctgtgca ggaaagaccc
   138841 caaaccgcgg tacccactga cttttagttt tccgagaaaa acagaaactg cggttgccgc
   138901 gttagcagct tttagagttt tcgttcgcct gtgcaggaaa gaccccaaac cgcggtaccc
   138961 actgactttt aattttccga gaaaaacaga aactgcggtt gccccgttag cagattttag
   139021 agttctcgtt cgcctgggca ggaaagaccc caaccgcggt acccactgat ctttatcttt
   139081 atgaagaaaa acaggaactg cggttgcccc gttagcagat tttagagttc tcgttcgcct
   139141 gggcaggaaa gacccccaaa ccgcggtacc cactgacctt tatttttccg agaaaaacag
   139201 caactgcggt tgccccgtta gcagatttta gagttctcgt tcgcctgggc aggaaagacc
   139261 ccaaccgcgg tacccactga tctttatctt tatgaagaaa aacaggaact gcggttgtcg
   139321 cgttagcagc ttttagagtt ttcattcgcc tgtgcaggaa agaccccaac cgcggtaccc
   139381 actgactttt aattttccga gaaaaacaga aactgcggtt gccccgttag cagattttag
   139441 agttctcgtt cgcctgggca ggaaagaccc caaccgcggt acccactgat ctttatcttt
   139501 atgaagaaaa acaggaactg cggttgcccc gttagcagat tttagagttc tcgttcgcct
   139561 gggcaggaaa gacccccaaa ccgcggtacc cactgacctt tatttttccg agaaaaacag
   139621 caactgcggt tgccccgtta gcagatttta gagttctcgt tcgcctgggc aggaaagacc
   139681 ccaaccgcgg tacccactga tctttatctt tatgaagaaa aacaggaact gcggttgccc
   139741 cgttagcaga ttttagagtt ctcattcgcc tgggcaggaa agaccccaac cgcggtaccc
   139801 actgaccttt aattttccga gaaaaacaga aattgcggtt gccgcgttag cagcttttag
   139861 agttttcatt cgcctgtgca ggaaagaccc caaccgcggt acccactgac ttttaatttt
   139921 ccgagaaaaa cagaaactgc ggttgccccg ttagcagatt ttagagttct cgttcgcctg
   139981 ggcaggaaag accccaaccg cggtacccac tgatctttat ctttatgaag aaaaacagga
   140041 actgcggttg ccccgttagc agattttaga gttctcattc gcctgggcag gaaagacccc
   140101 caaaccgcgg tacccactga cctttatttt tccgagaaaa acagcaactg cggttgcccc
   140161 gttagcagat tttagagttc tcgttcgcct gggcaggaaa gaccccaacc gcggtaccca
   140221 ctgatcttta tctttatgaa gaaaaacagg aactgcggtt gccccgttag cagattttag
   140281 agttctcatt cgcctgggca ggaaagaccc caaccgcggt acccactgac ctttaatttt
   140341 ccgagaaaaa cagaaattgc ggttgccgcg ttagcagctt ttagagtttt cattcgcctg
   140401 tgcaggaaag accccaaccg cggtacccac tgacttttaa ttttccgaga aaaacagaaa
   140461 ctgcggttgc cccgttagca gattttagag ttctcgttcg cctgggcagg aaagacccca
   140521 accgcggtac ccactgatct ttatctttat gaagaaaaac aggaactgcg gttgccccgt
   140581 tagcagattt tagagttctc attcgcctgg gcaggaaaga cccccaaacc gcggtaccca
   140641 ctgaccttta tttttccgag aaaaacagca actgcggttg ccccgttagc agattttaga
   140701 gttctcgttc gcctgggcag gaaagacccc aaccgcggta cccactgatc tttatcttta
   140761 tgaagaaaaa caggaactgc ggttgccccg ttagcagatt ttagagttct cattcgcctg
   140821 ggcaggaaag accccaaccg cggtacccac tgacctttaa ttttccgaga aaaacagaaa
   140881 ttgcggttgc cgcgttagca gcttttagag ttttcattcg cctgtgcagg aaagacccca
   140941 accgcggtac ccactgatct ttatctttat gaagaaaaac aggaactgcg gttgccccgt
   141001 tagcaatttt taaggttcta acccgcttgg gtaggaaaga ccctaaccac aacacccact
   141061 gacctttaac tttatggaaa aacaaattat tttgctcacc atgcagtttt ttatatatcg
   141121 ttatatctct acccaatcag cacccttgat gatgcataca ttaagggaat gttgattttt
   141181 ttttcattgt acccacttac gaataacgaa tcagaagcca gaaagtagaa tattttaatg
   141241 atgtattact catcatttcc taccacacct attaacttca gtatttatag gagaggcatt
   141301 tttccgttat gcgccattag ctgttcttct gctaactcgg acgcagcggt acagggtgag
   141361 ttatcagtgt cttataatgt gatgtctttt ttttattttc ttgtcggtat tttaaaagtg
   141421 gtcttttaag atgttgttaa atatatagtt ataaaatttt cggaaccgtg tagtcaataa
   141481 aacaatttat agaacggttc ctggcccaaa acagaaattg atttatgtcg tctttctgaa
   141541 ttacaggaaa attgcgaggg atgactttat caaatgtaaa attatatacc ctctgtgata
   141601 gatttatttt gtggagattg gaatgtacca tcgagcgtat atcaacgcaa gatgtggcta
   141661 tgatgggaca cggtcctatc tgtacatggt cgttttcatt aatcggaaat attatttttt
   141721 gacctccaag gagggatttt ataatattaa aattgtcaaa gttgatactt atgtctttcc
   141781 accacaagac taaaacctgt ccgtaagctc ttaaattttt tgtattcaga gatccatgta
   141841 atattccatg taacgggatg ttttcaagaa tggctcccgt taacatcgat tttccacatc
   141901 cgggtggacc gataaaacta acggtgtttt tttttcctcc tctgtggctt agccactgat
   141961 ataatatggt tcctgctaat atagggtcaa aagactgcag acagaacagc tggtaaaccg
   142021 ggttttcata aatctgaaag tcagtgtcta tgtgcgctat aaaatcgata gctttcctag
   142081 ttgctcttat tcttttttta gctatagata gagccctatg gattagcacg tccccgtgtg
   142141 ttagcgtcaa caattgcatg tatgatctaa tgtctcttcg tatccacgcg tcttccgtga
   142201 ctattccgag atcagacagc cattcgatgg ttcccagaaa tttagatttt aaagatatcc
   142261 cgttaatccc atcctttgga aacagcataa gtttgacatt aggtttttta ttaaaatggg
   142321 atatgatgtg ttttcgatgt atctcatcgc atacgtctcc cagttcgtta atatttgtcc
   142381 acgcccattg gaactgtggt ctaataattt gaagaagggc aaaggggatg taacttagac
   142441 tgaagacctg ggttccgcca ccattcttct ttgttttggc atacgtgcac caatcatcta
   142501 ttttaggggc gttcccgtcg aagaaatctt taattaatac gcccctgatt tccgttgtgt
   142561 gttttcctat cgttgcgctg ggaattccat ctaaagctat caataatatt agggagggtc
   142621 tgccagcttt attctccgct tgagcgtacc actttgcagg ggtggggacg gcagttttat
   142681 tattccagta attgagtatg acatcgatca ttttggtaca tgcagttatc catttaatat
   142741 cgggcgctcc cggtgagtgc atatccctga aatgtggcac ggacacgtta gagaatttac
   142801 agaaaaaatc cgtagatatt ccagggattt ctgcctccca ctccatgggg cctttgatag
   142861 tcaacatgat atatttgtcc ttagtccaga aatcatcact cggatttatt atggaaaaca
   142921 taccgtttgc gcctcccaag ttttttatag ttgtatacgg aaaataaggt aattcccctg
   142981 gcttgtcacc tctagatgtc tgcacatccg gacgatttgt tttggcaaca aattctcaat
   143041 atggatccga cggaactttt gtcggacgat gtaatctcgt ccacgtgtga cgaaaacact
   143101 gcagctggaa ctgatattat gcagcctttg tgcgttgata tgtctgttca accgacgaca
   143161 tcggggtgtc ataccggagc gatgatgtca gactcgtatt tctccaatga cacaccggat
   143221 caaaactgcc aatcgcattc gactttgacg gacctttcgc cggaagacat gaacaatcaa
   143281 atcaatgttc aacccaatca gatgaccttt caacccattt ccccaccgat acaggatcaa
   143341 aattatggct atagcaataa tatgattaat cccatcaaac ctgcatcaat tatcaaatta
   143401 catggtcatt cgataggaga aatgacagtt acagaccctt cctctcatgt taatgctcaa
   143461 cactttgtcc aacagtctaa tcctaaattc tttctaaata tgtatccgtg catgaccgct
   143521 aactcacaag gacccggaga atgtcagtct gtccataatc aatcttctgg aagcgggtct
   143581 aattcttatg acattaatac ggcaccccgc gatgaatgga tattcactac atccggcgga
   143641 gaatcctggg ttctgaaacg gaacacccct aatcctccaa atagcagaac taatttaatt
   143701 ttcaacaacg cacaaccgat tttccatacc caacctcaag tatctgggtt tagcgactgt
   143761 tcctatcagg ggggtggtct caattcacgt gagtatgtaa atttggcagg ttacactccc
   143821 gtgtgcaaca tgcagaatat caaaaactca tgggcgacac aactaggagc atccattgac
   143881 tgcatgactg cgtcaccaac tggtatagat gcgaatgtca actctgcttt ccagccggtg
   143941 ggggtggtat caaataatcg gggtgctaat gtttcaatgg gaggcatggg taattatata
   144001 gagaataaca gtccatggaa ccaatactat aaatcggaaa tggctaataa ttccataaat
   144061 gtcaaggagt cgaatgttta tggccatgtg gggtgtgtta atgacgccat ttccgataaa
   144121 caaggtggca ccgctaacgt cccatcttct ctattgaatc cggatcacca agattggatg
   144181 aggatgactg gtacgaacac acatatgtta aacaatataa atactaacac agaaatggaa
   144241 aactatgatt ttccggaaaa tgatggcaat gtccacggag ccaccggtgt agatttatca
   144301 accctgtcca atggtcagca gcatagcgca tttgaaggaa atggaacatt tcccgtggta
   144361 aacaccggca atccaagaac gacgttgaac tgtgctcctc agttgttctt gcttggagga
   144421 aacccgacaa ttgcacatcc aatgaatggg aataatgaaa ccccagataa aaatgtatgc
   144481 aagcctaccc ccagcacagg tgtaataaaa aaattaaact ttgacggtgt tgaccgaggg
   144541 ggaggaatag gaaattttcc caaactggcg tcttttgtag ctatgagaga aaaaatgtca
   144601 aacacggtca atccttcttg tggaactttt ctagaacagt tggagggatt acgccagcag
   144661 aattcatttg aaaaaaatat atcctttgct gatctacatt tttctgaaga agatgatgtg
   144721 ctttccagtg catcctcggt cagctgtaat agcaactgcg acatgaaaat cgaagtttcg
   144781 cagcaaggta tcactgtgtc taatttacaa caaggattta ggcaacaaat gaacatgaac
   144841 tcatccgtgg ttaaaatgga cgggagctat aaaacacaag agatgtcaaa tggctgcgcg
   144901 acagacgtca cggataatgc aggcaccatt caacaaaata aacgtataca ctctcaaaat
   144961 gagaatccag aggatggcca ggtacgggag ggagggtgtt cagacgtcag aaatgaacct
   145021 ccgcggaaaa gtgcgcgtat tcataacatg aagtccgaag gcgtgacttg cggtatgtgc
   145081 atgacggctg cggattccac acggcaggat gcgtctggag gttcgagcag cggaaccaag
   145141 aatgaatatt acgatgatga atcggaatta accggattgt cggatacaga cagcgacaac
   145201 gaagtccaat gctgtcaaga agtaacaaag gtcggcccca agacgtactc ctcagaaaac
   145261 tttaatcctg agtatcgcca agccaagaga ttgcttgccg acattccata cagaagatgg
   145321 attccagacc cagtcaatat ggaagacaac gacggtccgt tcattccaat agtgactaga
   145381 ccagccactg tgtgtatgaa cggtagacgc cggaggactt tcttccggca atgtgttacc
   145441 gctttcggtc ctctgagtaa gttaacttat ttcaaagaat tactgcagag ctacgtgtcc
   145501 aaaaataaca atagttattt aagtatcagt tggcctccca aacacggggt atatgtcatg
   145561 tcagagaaga aattagggta tgaacatata cctaccttga aggacaagtt tccactgcca
   145621 tgtgggtgga tgatggtcct tggagttgtc ggtgcagaac cgcccgcggc tctgaataaa
   145681 aacatggtga ttctcctgtg tgaaaataga tgggtgcttc tgcataatta ctcaaactct
   145741 acacacgagc tgtttttagc cgcctcggat ttgaaacagt ttatggagga gggtctgtct
   145801 agatgtgatc ctatatatga agaatcaaca gtgccgtacg gtgtggccat ggaaaactct
   145861 cttcgagatt tcttgagaaa cagtagaacg tttcaggatc ttatggatca aagggacaac
   145921 atgcacggat gtaactggac ctttaacgga atgcctggta gactaggtga cagagtcata
   145981 catctctgca atcctgaatc ggttgattcc ataccaggag acgaggccgt cgtatgtgaa
   146041 ggaagaccct tgtatttctt tgcatatgtt accactttca aatcaaaccc cgctactaag
   146101 gctaccgtgt taatagccgc ggataaagat ttaagaatat atggctatca taaaggtcgc
   146161 cccaggatac ggtacttgtg taagaacgta aaaactttct ttaaagccgg ggctagaaag
   146221 ttctatttag attttcagat tacacctaaa aggttgcttg ccgtcaacga agaggagtat
   146281 ctgaatactc tacaaaacgc tccttgtctg ctcttaaaac catctgtgtt tagaaatatt
   146341 tactctcagg aaggtaaata agaattccta tgtcaatagt tttacttcac agtccccacc
   146401 ctcttttttt aattaaaaca gaaaggccgt tggatccaat ctaccgagag atttactgtt
   146461 tctttgacat ttattaggga tacgtatatt gtgtaccttg taatttctat gtaaacttct
   146521 gctatttttt ttaatgttga gtaattgaac attgtaaata ggtaaactgt tttttcaaaa
   146581 tggttagaaa ttctatgtac ttattttttt ttctgtgtat tgtaaaaggg aagatttgta
   146641 aggacaaagt tcagtaacat ttaataaaga acatgtgaca cgatttctga ctctctcagt
   146701 aatttgtgta atttaataag agccaatacc aacgtgaggg aaacgtaggt tccggccaag
   146761 gtgaggaaaa cggaggttcc tgccaaggtg agggcaacgt agcttccgag ggataaaaaa
   146821 gtaattcgtt actatgagta gtcggataaa acatttgtag ttttttgtct aacacataat
   146881 aattatcttg ataacattca tgtcggaata aatccgatat aaacgtttcc atctgtagat
   146941 atcttggccc gttttccatc tgtagatatc ttggcccgtt tttgcgtgcc aacatagcac
   147001 ttttggttaa attgtttatc acatctcttc cgtagtcact taaaaaaaaa acaaaaaaga
   147061 catgaaatgt tatagtcggc ctacctgcaa tttatataag tacaaataaa cacagtaaaa
   147121 ataaaatgat tcacatatgg attaatacct aatgactaga ttgaaatcca tccacgttac
   147181 ggacaagggt ttttgaactt ggtcttgcat ggtatataca attgttctat tgtccgtgag
   147241 aggtcgacaa aacttctggc cttcattttg aaacagactg aacaaatatc aagttataaa
   147301 ttaaccggcg atgtcctgtg ttattactca gactatacat ccacatgcac acacgataaa
   147361 atggtatagt aatcattcag gtttacccga ggtgacgttt tccccgagta aatcgaacga
   147421 tacttacatt tcaccgtcta ggcaggtcga aatcaaggaa gagacagaag tcgatgagtt
   147481 aagaacgaca tagctatcac agcacgaagt aatcttcggt aacgtgctaa aaagcggtag
   147541 cgcagccatt ccacgatatg catggaaatg tattaaaata tacacaacca agaaatgcat
   147601 aattatctag cagcaatata gtttgttatt caaacaatga ttcttttatc ttcatttaaa
   147661 tataatatga atatttacag ctatatatac aattcaatat acacatggtc gataacgcac
   147721 tatttatata ttccaaaaaa caacaaaagt tatcgggggt tatatttatc tacatcgata
   147781 aagtgtacaa atgtatatgt aaacacaaca ggaaaatata catgtcccaa ggcgtataca
   147841 ttctaacacg cgcacataac ggtcaggtcc tcacgacagt aggttttata tttatcattt
   147901 tgatgttttc agattttact tctttcggat tgtaaaatac gtgcccaccc tgacataaag
   147961 cttgtccgag gtgtttatat acatattctt ttctttcgaa catattttgt gtagtatatc
   148021 tcccttggac tgtgaagatg ttgttaacca tcaataatcc cgcatttcta aaacgttgtt
   148081 ttgaagttcc ggtctgtaca aatatggtgc tgcaaattaa gaaaaactgc ataaatataa
   148141 aaaaaatccg gaaaagtcat ttatttaatt acgatctttt gtaaacagcg ctcaccataa
   148201 tgcgggagcc atgtgtgtcg gactggctat atcgtatttt atattagtcg ttgtcaggtt
   148261 ttctggcaaa gagtgccaca atgcgcttac gatggcagga tctatgtcgc tgtgcataac
   148321 cggaaaatcg gaaaaaaaat taacataaaa gattactcca aaaaatttgt tcctaccaat
   148381 cccctgttat ttaaactcac cgtatagttg ttccttgctg tccgaccatt gacaatattt
   148441 gtgaggcaag tcgcattgcg atggtttcca tcagttcctc agtttcaaac agtgcatttc
   148501 taaaccctct gttagaaaca taagttaaag aatctcaaac gatacatcgc acacagtata
   148561 aattcaaact tgcattaaaa aaaagagaaa atgagcttac ttacagtacg gaagataaat
   148621 aattcttcgt ctcgttttta tttaaacgtg aacaccattc gaaaccttgc agtgtttcaa
   148681 acctgacaaa aaacgaaatt caaaattaca attttagaat tgtgttccac ctgtatgtgg
   148741 caaagctaat aagaaacata aatgttgctt ttttagtaaa attgactgaa attacttaca
   148801 cgacgtagct atcgtttgga caatgggtat cgtttatagg cacgtatacg tcaacgatat
   148861 cttgccacgg ttcgaaatat tgagtctgag tccatgagtt agaagattct aacgtacgac
   148921 gaccatgctg cacgtctcgg tgacgacaac acgtatcatt agcgacacgt ttatacctca
   148981 atatgtcctc tatattaacg ggcgcaaagc gcgtgcaggt ttcccaatct tgcccgtcgt
   149041 tgtcttttcg aacgatcgca aacgaggtta acgtcttcat agtctgtccg ccattgtttc
   149101 gtattttcaa aatctcgata ctgacgatca gttcacttga gtgaataaat acatgtgtgc
   149161 cccacggaga ggcaagacat ggggaacgag aaaaaatttt atgattacga aggcttccag
   149221 ccccatagtt tctactctga aaggatgtag gtatgcgtgc ggggttgata cgtatgcgcg
   149281 tacaggggtg tggtctgtct tctaaggggg gggggggggg ggtagagtgg agagtgtaag
   149341 acaagtagtg caacgtttct agagtaacag gtgcatccga agacgcggca gggtgtatag
   149401 atgggactct ttttagtaaa ctcggggtgt ttatgtatct gggatgttac acttttttag
   149461 gtcgataaat acaaaatgca tgtctttcct tggcaataaa ggagacgtga tacaaaggca
   149521 cacaaacttg tacaggtact caccatagag tctctttcac tttgtagttt tggcgtagct
   149581 ctaatttagt agtcattgga cagaaagcta tcgccgtcat cgcggtcagt ggtttcaagc
   149641 gcctcatata ggccaaacta ttatagttgc tcccgaaagc gccataaagc agagacaggt
   149701 gaaggcctag gctactagag agaatttgcg atagaccctt aggcattatt ctatctttaa
   149761 aatttctcac tcctttgttg tcagccgaga gaggaacgca gattatgata tctccgaaca
   149821 tgatgctgcg ataaattaaa tatgattatt atctattcat ttatttatga tctcagtaga
   149881 ttccgacatc gaataaacaa gatgaaatga aacgctgcat ccttaccgtg cttgtgtctc
   149941 tatggtacaa ccgcagctat tgtcatcgca aacagcgtag ttcaggatgt ctgctatatc
   150001 ttctaaggta gtagtcgggt tttcatctac gggaacgaaa gctttaactc tttttaaact
   150061 taacatttcg gaggtagaaa atttagaaat gatttccgat agcgtccgtc tcctcggcgt
   150121 agaatttcta ccttcgtaaa tgttaaaata aatgtctttg tcatagtatt ttgcggtata
   150181 gctatgttta tcctctggag gcggtgtgga tttcacggtt cccgcacgtc ggtgggccgt
   150241 agcgttcgtt ggggccgtcg ccatcgaaaa cgcgcacaaa aatatcagcg cacaagatct
   150301 cggcggtttc atagcgctca gccttgcggt tgccattctt cgtctcagtc ttgtgaaaat
   150361 ttcgtatgcg cgagacaaac aggacaagga gtaaaggaag atgatgttaa atagactata
   150421 gacgagaaca aacgcgaaac agatcctatg acgacggcag acaataatta aacggttcgc
   150481 gtcggggaac attcgcgtga atcaaaagcc atgacaaatt aatgcaacta gagagtgcac
   150541 aaaaattata tatggctacc gacaacgtcg ggcgcgttca gagtcctgta ccgtgtgcga
   150601 ctgagacacg tagtgttcaa actctacctt ctaaaatcac acctcggtgg aaagatcgtg
   150661 cggcgtatcg ttgtcgaaca gcggactcga agatgagtcg gggccgatca tgttcatctg
   150721 cggcaatata aagcggagag ggaggcggta taaaacgata gcgaagaaaa atacatctga
   150781 tcgccaaatg gcgatcagta ctctgacgct catcttttcc gtaaccggcg tgtgtgtaga
   150841 ctgtcgtttt ggtggtcaga tattaagtct gcgtaattct ttcctctctt tttatctctt
   150901 tctctctatt ctgctatctt cctctgtctg tttatgaccg cgcccgttgc agcacttatc
   150961 acacaacgcg cgcaccggcg cgcgtttacc cgtttctccg gcctctccta ctcacctctg
   151021 aggcactcaa cggcactccg gccgggtcac ttgttctcat aaaagcggtc tatctccact
   151081 ccgctcagcc ggaccgtacc cggaccggaa cagttatcgc catatagctg ccgtttttct
   151141 gcagcggcga gtcggagtgc gctcgggccg agactccttt tttgtttcgt tttcctatat
   151201 catcgtcgcc ccgcggcgcg aggtcagacc gcgccagggc cgggacactt ttttgtccaa
   151261 caccgtttct ccgggagacg gaatacctcg cgttttaaaa attacgtcaa atcccccggg
   151321 ggggctaaaa aaaggggggg taataaccct aaccctaacc ctagggctag ccctaaccct
   151381 aaccctaacc ctaggtctag ccctaaccct aaccctaacc ctaggtctag ccctaaccct
   151441 aaccctaggt ctagccctaa ccaaaacatt aaccctaacc aaaacatcaa ccctaactct
   151501 aacaccaacg ataacactaa ccataaaact atccctaaca ctaaacctag ccctagccaa
   151561 agtactaacc ctaaccgtag ccaaagtact aaccctagcc atacccctag tcataaccct
   151621 agccataacc gcataactct gttcacaacc ctaacactaa tcctcgcatc cgcacctaac
   151681 gctgcccctc tttcacacca tcaccccctg ccgcttcaac ttcaccttct tcctccatct
   151741 cgccccgctt gtttctacac ttgtccgccc ctctattctt actctaggat gccgctaacg
   151801 gtgcgtgccg ggcacgcgcc atatcgtctt ccgctctcca attattggtg gctactcttg
   151861 ggtcgacatt cccttcgtca tgttcattcc tacctgcgtc tgcacaaggg tctacgcatt
   151921 cctttacctt ggcccgagca ggaatgccta catttacatc ctaagcctta caagtgtctc
   151981 ctgcgttacc cctgtataac aagacaaccg catcttcttc agggctggcc tacgaagtct
   152041 tctctatgtg agtgtcatat acatttccac tttttcacat gatttattgc gttttgtcta
   152101 ctacaccggg tacattttgg tttccctcag ggttcgaccc taaaccctac catccttcgg
   152161 ccgacagcaa gttgctaccg ctgggcctaa ttacgctgtc cgcctgttcc acgcgcgtgt
   152221 cggctacgac acgctggagc agcttccacg cgacagatcc gtctctcagc tggctgacag
   152281 gatcgtcccc ttggctcgtg atcctacaag ggcagggggg gtctctgttc tgccacgacg
   152341 tgctgcaagg ccgactctat atcctgtcgc actccgtgtc gctctttcta aagacgggcc
   152401 tccgccactg cgaggccatc tatcgcgcac cgctgtggcg cgaccgaccc ctgccgagcc
   152461 tgtggacgtg ccgggacccc gacaaggcct tcttgccgac attactggcg agaagcgccc
   152521 gacgcggcct ggccgctttc tacgccctgt ggagactgca tctgggatcg cgctcggagc
   152581 tctcccaccc cgtgttggag tgggagagca cagagctggt cctgacggac tggagacgcg
   152641 ggcgaaatga ggcacagaga gacgcgccca gcgtcgcgga acacttcgcg aggtgcagac
   152701 cgctgctgga cgaactgtgc ggagagggcg gatggcttcc cttcgcgttt ctctccacat
   152761 ctccgcacgt ctggctgatc ctaacggaag gaggccccgt cctggcggtt gacgtgaacg
   152821 acacctccgt gtggcgcatc gcggacgacc tggagctgct gcgtcgcctg gggagtctgc
   152881 tcctcctctc aggcctccgg cttcctctcc gtcccccgag cgggagcggc gaggcggccg
   152941 gagagccggg gtacgaggag gaagagagaa gagggagagc gtcgacggcg agcgcgacgg
   153001 ccgcgacgtc gacgcgcgga ccgacccgtc cgacacgggt gacgcgtaag gggcgtgtgg
   153061 caaccggagg cgtccatctc tccgcacgcc ccgaatctga ggaacagaca gacggccacc
   153121 acgggcgcca ggagagcagc gacgaccacc agcgcggcgg tagcggacga ggacaccgcg
   153181 atgacggcgc gcaccgccac gcgaatgaca aaacagagcc ccagcagcgc ggagagcacg
   153241 aggaaaggaa acagaccgac tccgggcgcc acgagcacgc acaggagagc caggtcgcaa
   153301 gaagagacga ggaggaaacg gagcagggcg atagcgaaag gagctgcggg ggggcgacgc
   153361 agacgtacgg cggcagaggc cgacatgatt cctgcccgtc gatccccctg tccgtccccg
   153421 ggcccgatcc ccgcctgtgg gtccctcccc ctcatctgtt attcccttcc cctctgccac
   153481 cgatgacgcc cgtcgacgac gagccgtccg tccgccctcg gtgtccgcca ggtcccgcgg
   153541 aggaaccccc cacgtgtcgt ccccgtccgc cccgcccgtc gtccgacacc ccgctgtccg
   153601 ctgtctcgcg cccctccgct ccgcccgtcc ccccgccgtc cactgcgcgt gtccgtttct
   153661 tcctctcttc ctcctcctcc tccccgtcct actctcccgc tccgttgtct ccgccctctc
   153721 ccgtctctcc ctcgtctccc agatctccgt tcatcccccc catcagatct ccgggactcc
   153781 gagcgaaacc gcgggtgtcc tccgggcatc ccgcggcgtt cccgccggcg ccctcgtccg
   153841 cgccggcccg ttccgaaaga gtcacgtccg ttccctcatc ggcatctccg tccgcgtcgt
   153901 gcgtcggcaa gtcacagccg cccgccgcac acacggcgtg agacgccgcg cgaggtgacg
   153961 gaggcgacga aagaggacgg gaagaacagg cggaagaaca cgaagacgaa gaggaagaag
   154021 atacgagaac aaaatgaggg gaacacgccg gggaccgagc ggcggatgga gcccgctcgg
   154081 tctcgcactt ccgcgatacc cagcgggctc cgtcgccgct tcggacccga ggtccgacac
   154141 gcccccacct cgcgcaccgc ctccgccacc accgctgaca acctccgcat atcgccccca
   154201 tacacaccca gcagcagagt ccggcgcacg cacacgcgcg gagcacgcac gacaacacgc
   154261 cagacatcga ccgccggagg taacggagcc cgtgcacgtc ccggttttag cgggagtgtg
   154321 tgcgcgcgta ccgtaacaag gaaaacccag cgggacgaaa cgatcgaccc actcctacta
   154381 tccgccctcc ccgagcacgg tccacacgcc agtccgtaaa atcacccgag gggcggatcc
   154441 gctccgcgcc cctcgcccga tccgccccga taaaaacaag tcatctcact cgtgccagtt
   154501 cacacggacg cgaccgatga caataaaaaa aaaaaacaca ccaccacaac cgaacgcccg
   154561 ccggcccatc caccttccct cccacccccg ctcgagtcgc gcaggcgcgt cgacgggcag
   154621 tccctcggac gcctctacgg caacgctcct cccctgtccc ctcggtccaa cccctcccat
   154681 ccccctcccc ggagcacaca cgccgactcc gtccgcagag gcggcgaccg cagcggcagc
   154741 ggaaactgta acggccacgt tctccgaaca gcgacagtaa cggcggcggc ggcggttgtc
   154801 gccgtcacgg tagtcgtggc ggagcacccg gggaggcgac gacaggtacc accggcgccg
   154861 agatcatcgc cgtacgaaaa gagtaccgaa tgcaaaaagt taaaggtttt ttgtaaataa
   154921 aaaaaaaata gtacgtggaa ataaaaaata aaaaaaaata tacaatataa tagtgtatta
   154981 taaaataaaa acagaataaa ggctaaacac cggccaaacg ctcatccttc tccgtacgtc
   155041 ccctttccgt aagtgccaaa tgccacatat ccatgaacgg acacacgccg gcagaatccg
   155101 gccttcctga cagcaggtag cccgcgacct aagcacagga cggtacctga aaccgaaagc
   155161 gtaaagggcg gtctcccttg ttccgcccat gaggcgggac ttcgagacga gccacccttc
   155221 gtatacgtcc ggcccctccc acgcgcgcct ataggacgca ccccctcgtt gcgaaaccgc
   155281 aacagggcac agttgccgtc acaccccctg tccctagctc gcgacgggcc ggcgcagacc
   155341 ctgccgcggc ggcaaagccg agacaagacc ccgacgtacg cgggcataaa gaacgagaag
   155401 tcgacgcgca atcccaaatt atcgcgagac tgtttgctcg ggcccgccct cgtcctcatg
   155461 ccctctcccc gccctcatcc ccttccacac ccggtagaca aaaaaaaaca aaaaatacat
   155521 aggtaaaagt gattttcgcg gttaaacatt tttccacgtg acgtccccgg cgattcccgg
   155581 agatgcgaca cgcgacacat tggcccgttg acatcggggt ccgcagacgc ggttcccccg
   155641 ggggcgtcgc gacgtcggtt ccgcagaaaa caccgcggtc cgccgtcacc cttcaatcac
   155701 gcggtatttc cgcgctccta tgatatatct ccaccgacac gggttctgtc tgtcactttt
   155761 taccgagccg ctccaccatc gacagtgtca ctgactacat cgcatacgtg ctgttttgcc
   155821 tgtttcttgt ttatctcccc acccctcccc gtcacagacc agcaaacacc ttgccacatc
   155881 gacatcgcgg gcggcaaatt aaaaaaaaaa ataacataaa tatagtgaaa gagaggcccc
   155941 cgtcccacat aaggacagaa gaacaggcaa aaaaaaaaac ccgtccgtta ttcacacagc
   156001 attcggaaag ccatgtcgac gcgacacaca cagaggacgg gcggacgcat ctcggtccgg
   156061 cgcaacgagg cgagactggc ccacgcgcga gcccgtgccc gcttcgactg gctgctcctg
   156121 gcccgcggca ggccgtccaa actgtacggc tatgcgagcc ggcatcgcgg agaactgatc
   156181 cacctaccgt ggccgccgtg ctggtgtcta gaactccacc acgatccgta cagagacgcc
   156241 agaagtgcca ccgtgtgggg ccaccgctgg ggttggccag cgacgcacgt gagacccaga
   156301 tgcgttcaag actgcggtga gtaaacgtac gggcgagccg cggggaggga tgtcggtcag
   156361 acagtgagtg agtacaaggt tcgtcgagaa ccaccagaga caccagccgg tagagagtgg
   156421 ggacaaaaaa aaaacgtcac gtcaggggcg gcgagtaacg gaaaacgagt atgaatacga
   156481 ggaggggaga cgaaacatag tcaagtatgt gacgcgccgg atcgtaaggc agtaaagccg
   156541 atgacggcct ccggccccag agacgactcg cggagtggag tccagttatt gtattttttt
   156601 tgtgattttt tttatccaca atccggtatc cgtgaatccc cgcagaggta ctttccatta
   156661 acgatggtac aggcggtata acttccggaa cacggtgatt acggatatcc tgtctcgttt
   156721 acgcgagacc tctttgttgt aatctcctat aacggtaaaa aaaaacacaa aagaaagatt
   156781 acagctcctc cttttttctg cgttatggca tcctcgcatt agtcaccatt cctgtcgcgt
   156841 gtgcttttcg ctttgaattg tacgcgacag gatacgaatc cgttatactc cacaagggca
   156901 tagcgaccac ggctgtatgc ggcatctccc gttccacggg atgcctttgc gtgtgcagat
   156961 gttctgtgct ttttttatac ggtcagagac cacagacaaa aataaggcaa cgcccaccat
   157021 aacgtttatg gtttcttgtt gttttgtttg ggttaaacgc ctcttctatc gtgtcggccg
   157081 gatccatcat gttcaatcgt tgacgtacgc gcgtcccatc acagccctag actcctgtct
   157141 gtacgtatgt tgcggatacg gagagaaact tcaacccgtg ggtttcgtaa agtcgtatgt
   157201 aaccaactcc cagctcgaca cgctccgcgt gctcctggtg ggcaaagacg gagccgtgta
   157261 cgtccaccac atgagggcgg caagactctg ccgactggcg tcgagcacaa cggagtttac
   157321 aagacgaggg ctgcaacgcg acgccgtgac gtatgaagaa gacctagagc tgccggacca
   157381 gcgtatgtgc ggaacgaacg cccgacatct gttcgacgtg atcgccgcgg ccgccgacga
   157441 acacaacctg ctgaccgtcg gcggcctgtg tcagacgcac gccggagtgt cctgcaactt
   157501 actagagacc gtgggagatc cgtggacggc ggttccggcc gcgcgcatga ctctgaccgt
   157561 gccgcaggtt cagtaccggt tatggcccga agcccggaga gacctccgcc ggcacctgta
   157621 cgcgggccac cccctgggac cgtggctcgt gtgcggcgtt ctctctcgag agagggagac
   157681 gcagaagccg tcgcctccga tacgtacgac tgtgggaaac gtaccaacgc cggggccacg
   157741 cgaggtggag atcgcttggg tggtcttgac tttggcggga cctctgttag cgttctggcc
   157801 cgataccggc aagatctgtc gtctggcaaa ctcgttttcc accttatgga agatgggacc
   157861 gcgggccatg agaggacact ggacgtactc ggccccgggt agacatctcc ccggggacgc
   157921 gtggccactg tgcgaacacg tgagaccgca ggtgggaaag cttccgagga agagagcgta
   157981 cctggattag acgccacgga ggtgaagtaa gcatgtcacc tacggccaga gacgtgaccg
   158041 gagaaaatca tgcattgtgt ggggtgtgta tgcgtggggt gcgtatcggt gcgcgtactc
   158101 gttttccttc cctcttccct ttaaccccac gaaaaataaa atccacgaac gtagacagtc
   158161 acacacaggg tgcttacgct ccgtgttact gatggcaggt aaccaaaaaa acgtatgtgt
   158221 cggccgtgat gcaccgccgc tctatagcgt agtcgctata gcagcgcccg atgccaacgc
   158281 gacagggtga gtcacataga tcgggactgc ttgaaagcgc gtcgttcgct tcttatatag
   158341 gcaccccggg gggtgggagg agtgaacata caaaggaggt gcgtccggga ttggaggcga
   158401 acgtagaaaa cgaacagcgt cagaaaaata taagaaaagg cggagacaca tagccttggc
   158461 gggaagacga caacaggttt aaaaatagac agtgaaaaaa atagcagact gtgacgtcca
   158521 atacacatgt ggcgatcatc caatcaacgg ggtgtatcga ggcgcagaga caaaagtatg
   158581 cggaagtaca cacgacacgg taacgcggac cgaagacaga gggcgatcgc tagcatggca
   158641 agtgtaagaa aaaaaaaacc acgttccaaa aacacctata cgggaaacat ctcttcactc
   158701 cctccccgtc ccaaccaccg caacattcac ctccgtaatc cgttgtcacc gcgtttctac
   158761 cacggacgcg tacacacgca gacacacaga cacgcacaac ccacccatgt ggtagtcgcg
   158821 ggtgggtacg tagatggggc ataccggggt gagacgtgaa gacaattcaa aacgacatcg
   158881 cgcgcgacgt gccaccgtct gggacccacg gtcgcctggc acggtgccaa aggaaaccac
   158941 cggctaaccc taaccctaac cctaacccta accctaaccc taaccctaac cctaacccta
   159001 accctaaccc taaccctaac cctaacccta accctaaccc taaccctaac cctaacccta
   159061 accctaaccc taaccctaac cctaacccta accctaaccc taaccctaac cctaacccta
   159121 accctaaccc taaccctaac cctaacccta accctaaccc taaccctaac cctaacccta
   159181 accctaaccc taaccctaac cctaacccta accctaaccc taaccctaac cctaacccta
   159241 accctaaccc taaccctaac cctaacccta accctaaccc taaccctaac cctaacccat
   159301 cccccaacgc gcgcgcgcac gccgctatgg gaggcgccgt gtttttcacc aacacgcgcg
   159361 ccgctgcgag acgcgtga
//