LOCUS       X81420                  1637 bp    mRNA    linear   HUM 18-APR-2005
DEFINITION  H.sapiens mRNA for hHKb1 protein.
ACCESSION   X81420
VERSION     X81420.1
KEYWORDS    basic keratin; type II keratin.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1
  AUTHORS   Rogers,M., Nischt,R., Korge,B., Kreig,T., Fink,T.M., Lichter,P.,
            Winter,H. and  Schweizer,J.
  TITLE     Sequence data and chromosomal localization of human type I and type
            II hair keratin genes
  JOURNAL   Exp. Cell Res. 220(2), 357-362(1995).
   PUBMED   7556444
REFERENCE   2  (bases 1 to 1637)
  AUTHORS   Schweizer,J.
  JOURNAL   Submitted (05-SEP-1994) to the INSDC. J. Schweizer, German cancer
            research center, Research program 2, im Neuenheimer feld 280, 69120
            Heidelberg, FRG
COMMENT     Related sequence; X75649.
FEATURES             Location/Qualifiers
     source          1..1637
                     /db_xref="H-InvDB:HIT000323841"
                     /organism="Homo sapiens"
                     /chromosome="12"
                     /map="12q13"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             <1..1280
                     /codon_start=3
                     /gene="HKb1"
                     /product="hair type II basic keratin"
                     /db_xref="GOA:Q14533"
                     /db_xref="H-InvDB:HIT000323841.13"
                     /db_xref="HGNC:HGNC:6458"
                     /db_xref="InterPro:IPR001664"
                     /db_xref="InterPro:IPR003054"
                     /db_xref="InterPro:IPR018039"
                     /db_xref="UniProtKB/Swiss-Prot:Q14533"
                     /protein_id="CAA57180.1"
                     /translation="VSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNSRFAAFIDKV
                     RFLEQQNKLLETKLQFYQNRECCQSNLEPLFEGYIETLRREAECVEADSGRLASELNH
                     VQEVLEGYKKKYEEEVSLRATAENEFVALKKDVDCAYLRKSDLEANVEALIQEIDFLR
                     RLYEEEIRILQSHISDTSVVVKLDNSRDLNMDCIIAEIKAQYDDIVTRSRAEAESWYR
                     SKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAVAQSEQQ
                     GEAALSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEE
                     QRLCEGIGAVNVCVSSSRGGVVCGDLCVSGSRPVTGSVCSAPCNGNVAVSTGLCAPCG
                     QLNTTCGGGSCGVGSCGISSLGVGSCGSSCRKC"
BASE COUNT          362 a          469 c          520 g          286 t
ORIGIN
        1 ccgtgtcggt caacgagagc ctcctcacgc ccctcaacct ggagatcgac cccaacgcgc
       61 agtgcgtgaa gcaggaggag aaggagcaga tcaagtccct caacagcagg ttcgcggcct
      121 tcatcgacaa ggtgcgcttc ctggagcagc agaacaaact gctggagaca aagctgcagt
      181 tctaccagaa ccgcgagtgt tgccagagca acctggagcc cctgtttgag ggctacatcg
      241 agactctgcg gcgggaggcc gagtgcgtgg aggccgacag cgggaggctg gcctcagagc
      301 ttaaccacgt gcaggaggtg ctggagggct acaagaagaa gtatgaggag gaggtttctc
      361 tgagagcaac agctgagaac gagtttgtgg ctctgaagaa ggatgtggac tgcgcctacc
      421 tccgcaagtc agacctggag gccaacgtgg aggccctgat ccaggagatc gacttcctga
      481 ggcggctgta tgaggaggag atccgcattc tccagtcgca catctcagac acctccgtgg
      541 ttgtcaagct ggacaacagc cgggacctga acatggactg catcattgcc gagattaagg
      601 cacagtatga cgacattgtc acccgcagcc gggccgaggc cgagtcctgg taccgcagca
      661 agtgtgagga gatgaaggcc acggtgatca ggcacgggga gaccctgcgc cgcaccaagg
      721 aggagatcaa tgagctgaac cgcatgatcc aaaggctgac ggccgaggtg gagaatgcca
      781 agtgccagaa ctccaagctg gaggccgcgg tggctcagtc tgagcagcag ggtgaggcag
      841 ccctcagtga tgcccgctgc aagctggccg agctggaggg cgccctgcag aaggccaagc
      901 aggacatggc ctgcctgatc agggagtacc aggaggtgat gaactccaag ctgggcctgg
      961 acatcgagat cgccacctac aggcgcctgc tggagggcga ggagcagagg ctatgtgaag
     1021 gcattggggc tgtgaatgtc tgtgtcagca gctcccgggg cggggtcgtg tgcggggacc
     1081 tctgcgtgtc aggctcccgg ccagtgactg gcagtgtctg cagcgctccg tgcaacggga
     1141 acgtggcggt gagcaccggc ctgtgtgcgc cctgcggcca attgaacacc acctgcggag
     1201 ggggttcctg cggcgtgggc tcctgtggta tcagctccct gggtgtgggg tcttgcggca
     1261 gcagctgccg gaaatgttag gcaccccaac tcaagtccca ggccccaggc atctttgcct
     1321 gccctgcctt gcttggccca gtcagtcagg cgcctggaga agtgctcagc tacttctcct
     1381 gcactttgaa agacccctcc cactcctggc ctcacatttc tctgtgtgat cccccacttc
     1441 tgggctctgc caccccacag tgggaaaggc caccctagaa agaagtccgc tggcacccat
     1501 aggaaggggc ctcaggagca ggaagggcca ggaccagaac cttgcccacg gcaactgcct
     1561 tcctgcctct ccccttcctc ctctgctctt gatctgtgtt tcaataaatt aatgtagcca
     1621 aaaaaaaaaa aaaaaaa
//