LOCUS       X77094                  1245 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  H.sapiens mRNA for p40phox.
ACCESSION   X77094
VERSION     X77094.1
KEYWORDS    p40phox gene.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1
  AUTHORS   Wientjes,F.B., Hsuan,J.J., Totty,N.F. and  Segal,A.W.
  TITLE     p40phox, a third cytosolic component of the activation complex of
            the NADPH oxidase to contain src homology 3 domains
  JOURNAL   Biochem. J. 296, 557-561(1993).
   PUBMED   8280052
REFERENCE   2  (bases 1 to 1245)
  AUTHORS   Wientjes,F.B.
  JOURNAL   Submitted (23-FEB-1994) to the INSDC. Department of
            Medicine,University College London,Rayne Institute, 5 University
            Street, London WC1E 6JJ, UK.
FEATURES             Location/Qualifiers
     source          1..1245
                     /db_xref="H-InvDB:HIT000323609"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /dev_stage="retinoic acid-induced"
                     /clone_lib="lambda gt10"
                     /cell_line="HL60"
                     /cell_type="HL60"
                     /db_xref="taxon:9606"
     CDS             131..1150
                     /gene="p40phox"
                     /product="p40phox protein"
                     /db_xref="GOA:Q15080"
                     /db_xref="H-InvDB:HIT000323609.13"
                     /db_xref="HGNC:HGNC:7662"
                     /db_xref="InterPro:IPR000270"
                     /db_xref="InterPro:IPR000919"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="PDB:1H6H"
                     /db_xref="PDB:1OEY"
                     /db_xref="PDB:1W6X"
                     /db_xref="PDB:1W70"
                     /db_xref="PDB:1Z9Q"
                     /db_xref="PDB:2DYB"
                     /db_xref="UniProtKB/Swiss-Prot:Q15080"
                     /protein_id="CAA54372.1"
                     /translation="MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIE
                     VKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIA
                     EMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQAIRRLRPRTRKVKSV
                     SPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGI
                     FPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRR
                     EFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRV
                     YNTMP"
BASE COUNT          282 a          378 c          355 g          230 t
ORIGIN
        1 ggggagagtc tcgcccagcc agtcccaggc tgagttcacc tctcacttcc tccagccacc
       61 ctgcgtctcg tctcagcctg ggactggctg ggcgagactc tccacctgct ccctgggacc
      121 atcgcccacc atggctgtgg cccagcagct gcgggccgag agtgactttg aacagcttcc
      181 ggatgatgtt gccatctcgg ccaacattgc tgacatcgag gagaagagag gcttcaccag
      241 ccactttgtt ttcgtcatcg aggtgaagac aaaaggagga tccaagtacc tcatctaccg
      301 ccgctaccgc cagttccatg ctttgcagag caagctggag gagcgcttcg ggccagacag
      361 caagagcagt gccctggcct gtaccctgcc cacactccca gccaaagtct acgtgggtgt
      421 gaaacaggag atcgccgaga tgcggatacc tgccctcaac gcctacatga agagcctgct
      481 cagcctgccg gtctgggtgc tgatggatga ggacgtccgg atcttctttt accagtcgcc
      541 ctatgactca gagcaggtgc cccaggccat ccgccggctc cgcccgcgca cccggaaagt
      601 caagagcgtg tccccacagg gcaacagcgt tgaccgcatg gcagctccga gagcagaggc
      661 tctatttgac ttcactggaa acagcaaact ggagctgaat ttcaaagctg gagatgtgat
      721 cttcctcctc agtcggatca acaaagactg gctggagggc actgtccggg gagccacggg
      781 catcttccct ctctccttcg tgaagatcct caaagacttc cctgaggagg acgaccccac
      841 caactggctg cgttgctact actacgaaga caccatcagc accatcaagg acatcgcggt
      901 ggaggaagat ctcagcagca ctcccctatt gaaagacctg ctggagctca caaggcggga
      961 gttccagaga gaggacatag ctctgaatta ccgggacgct gagggggatc tggttcggct
     1021 gctgtcggat gaggacgtag cgctcatggt gcggcaggct cgtggcctcc cctcccagaa
     1081 gcgcctcttc ccctggaagc tgcacatcac gcagaaggac aactacaggg tctacaacac
     1141 gatgccatga gctgacggtg tccctggagc agtgagggga caccagcaaa aaccttcagc
     1201 tctcagagga gattgggacc aggaaaacct gggaggatgg gcaga
//