LOCUS       X76342                  2055 bp    mRNA    linear   HUM 28-DEC-1994
DEFINITION  H.sapiens ADH7 mRNA.
ACCESSION   X76342
VERSION     X76342.1
KEYWORDS    ADH7 gene; alcohol dehydrogenase.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1
  AUTHORS   Farres,J.
  JOURNAL   Submitted (25-NOV-1993) to the INSDC. J. Farres, Universitat
            Autonoma de Barcelona, Dept de Bioquimia i Biologia Molecular,
            Facultat de Ciencies, Bellaterra, 08193 Barcelona, SPAIN
  REMARK    revised by [3]  MAT
REFERENCE   2  (bases 1 to 2055)
  AUTHORS   Farres,J., Moreno,A., Crosas,B., Peralba,J.M., Allali-Hassani,A.,
            Hjelmqvist,L., Jornvall,H. and  Pares,X.
  TITLE     Alcohol dehydrogenase of class IV (sigma sigma-ADH) from human
            stomach. cDNA sequence and structure/function relationships
  JOURNAL   Eur. J. Biochem. 224(2), 549-557(1994).
   PUBMED   7925371
REFERENCE   3  (bases 1 to 2055)
  AUTHORS   Farres,J.
  JOURNAL   Submitted (13-JUN-1994) to the INSDC. J. Farres, Universitat
            Autonoma de Barcelona, Dept de Bioquimia i Biologia Molecular,
            Facultat de Ciencies, Bellaterra, 08193 Barcelona, SPAIN
FEATURES             Location/Qualifiers
     source          1..2055
                     /db_xref="H-InvDB:HIT000323579"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /clone_lib="human stomach cDNA"
                     /tissue_type="stomach"
                     /db_xref="taxon:9606"
     CDS             25..1185
                     /note="alternative ORF"
                     /db_xref="GOA:P40394"
                     /db_xref="H-InvDB:HIT000323579.14"
                     /db_xref="HGNC:HGNC:256"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028635"
                     /db_xref="PDB:1AGN"
                     /db_xref="PDB:1D1S"
                     /db_xref="PDB:1D1T"
                     /db_xref="UniProtKB/Swiss-Prot:P40394"
                     /protein_id="CAA53960.1"
                     /translation="MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPP
                     KTKEVRIKILATGICRTDDHVIKGTMVSKFPVIVGHEATGIVESIGEGVTTVKPGDKV
                     IPLFLPQCRECNACRNPDGNLCIRSDITGRGVLADGTTRFTCKGKPVHHFMNTSTFTE
                     YTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAAVKTGKVKPGSTCVVFGLGGVGLS
                     VIMGCKSAGASRIIGIDLNKDKFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGY
                     TFEVIGHLETMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGL
                     KSRDDVPKLVTEFLAKKFDLDQLITHVLPFKKISEGFELLNSGQSIRTVLTF"
     CDS             61..1185
                     /gene="ADH7"
                     /product="alcohol dehydrogenase"
                     /EC_number="1.1.1.1"
                     /note="class IV"
                     /db_xref="GOA:P40394"
                     /db_xref="HGNC:HGNC:256"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028635"
                     /db_xref="PDB:1AGN"
                     /db_xref="PDB:1D1S"
                     /db_xref="PDB:1D1T"
                     /db_xref="UniProtKB/Swiss-Prot:P40394"
                     /protein_id="CAA53961.1"
                     /translation="MGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILAT
                     GICRTDDHVIKGTMVSKFPVIVGHEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECN
                     ACRNPDGNLCIRSDITGRGVLADGTTRFTCKGKPVHHFMNTSTFTEYTVVDESSVAKI
                     DDAAPPEKVCLIGCGFSTGYGAAVKTGKVKPGSTCVVFGLGGVGLSVIMGCKSAGASR
                     IIGIDLNKDKFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMI
                     DALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTE
                     FLAKKFDLDQLITHVLPFKKISEGFELLNSGQSIRTVLTF"
BASE COUNT          650 a          366 c          436 g          603 t
ORIGIN
        1 ctgagcatca gtcagaaaaa gtctatgttt gcagaaatac agatccaaga caaagacagg
       61 atgggcactg ctggaaaagt tattaaatgc aaagcagctg tgctttggga gcagaagcaa
      121 cccttctcca ttgaggaaat agaagttgcc ccaccaaaga ctaaagaagt tcgcattaag
      181 attttggcca caggaatctg tcgcacagat gaccatgtga taaaaggaac aatggtgtcc
      241 aagtttccag tgattgtggg acatgaggca actgggattg tagagagcat tggagaagga
      301 gtgactacag tgaaaccagg tgacaaagtc atccctctct ttctgccaca atgtagagaa
      361 tgcaatgctt gtcgcaaccc agatggcaac ctttgcatta ggagcgatat tactggtcgt
      421 ggagtactgg ctgatggcac caccagattt acatgcaagg gcaaaccagt ccaccacttc
      481 atgaacacca gtacatttac cgagtacaca gtggtggatg aatcttctgt tgctaagatt
      541 gatgatgcag ctcctcctga gaaagtctgt ttaattggct gtgggttttc cactggatat
      601 ggcgctgctg ttaaaactgg caaggtcaaa cctggttcca cttgcgtcgt ctttggcctg
      661 ggaggagttg gcctgtcagt catcatgggc tgtaagtcag ctggtgcatc taggatcatt
      721 gggattgacc tcaacaaaga caaatttgag aaggccatgg ctgtaggtgc cactgagtgt
      781 atcagtccca aggactctac caaacccatc agtgaggtgc tgtcagaaat gacaggcaac
      841 aacgtgggat acacctttga agttattggg catcttgaaa ccatgattga tgccctggca
      901 tcctgccaca tgaactatgg gaccagcgtg gttgtaggag ttcctccatc agccaagatg
      961 ctcacctatg acccgatgtt gctcttcact ggacgcacat ggaagggatg tgtctttgga
     1021 ggtttgaaaa gcagagatga tgtcccaaaa ctagtgactg agttcctggc aaagaaattt
     1081 gacctggacc agttgataac tcatgtttta ccatttaaaa aaatcagtga aggatttgag
     1141 ctgctcaatt caggacaaag cattcgaacg gtcctgacgt tttgagatcc aaagtggcag
     1201 gaggtctgtg ttgtcatggt gaactggagt ttctcttgtg agagttccct catctgaaat
     1261 catgtatctg tctcacaaat acaagcataa gtagaagatt tgttgaagac atagaaccct
     1321 tataaagaat tattaacctt tataaacatt taaagtcttg tgagcacctg ggaattagta
     1381 taataacaat gttaatattt ttgatttaca ttttgtaagg ctataattgt atcttttaag
     1441 aaaacataca cttggatttc tatgttgaaa tggagatttt taagagtttt aaccagctgc
     1501 tgcagatata taactcaaaa cagatatagc gtataaagat atagtaaatg catctcctag
     1561 agtaatattc acttaacaca ttgaaactat tattttttag atttgaatat aaatgtattt
     1621 tttaaacact tgttatgagt taacttggat tacattttga aatcagttca ttccatgatg
     1681 catattactg gattagatta agaaagacag aaaagattaa gggacgggca catttttcaa
     1741 cgattaagaa tcatcattac ataacttggt gaaactgaaa aagtatatca tatgggtaca
     1801 caaggctatt tgccagcata tattaatatt ttagaaaata ttccttttgt aatactgaat
     1861 ataaacatag agctagagtc atattatcat acttatcata atgttcaatt tgatacagta
     1921 gaattgcaag tccctaagtc cctattcact gtgcttagta gtgactccat ttaataaaaa
     1981 gtgtttttag tttttaacaa ctacactgat gtatctatat atatctataa catgttaaaa
     2041 attcttaaga aaatt
//