LOCUS       X76228                  1319 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  H.sapiens mRNA for vacuolar H+ ATPase E subunit.
ACCESSION   X76228
VERSION     X76228.1
KEYWORDS    ATPase epsilon subunit; vacuolar H+ ATPase E subunit.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1319)
  AUTHORS   Lipinski M.
  JOURNAL   Submitted (02-NOV-1993) to the INSDC. M. Lipinski, Lab. de Biologie
            des Tumeurs Humaines, CNRS URA 1156, Inst. Gustave Roussy, 94805
            Villeuif Cedex, FRANCE
REFERENCE   2  (bases 1 to 1319)
  AUTHORS   Baud V., Mears A., Lamour V., Scamps C., McDermid A., Lipinski M.
  TITLE     The E subunit of vacuolar H(+)-ATPase localizes close to the
            centromere on human chromosome 22
  JOURNAL   Hum. Mol. Genet. 3(2), 335-339(1994).
   PUBMED   8004105
FEATURES             Location/Qualifiers
     source          1..1319
                     /db_xref="H-InvDB:HIT000323577"
                     /organism="Homo sapiens"
                     /chromosome="22q11"
                     /mol_type="mRNA"
                     /clone="61EW"
                     /cell_line="IARC-EW11"
                     /tissue_type="Ewing tumour"
                     /germline
                     /db_xref="taxon:9606"
     CDS             76..756
                     /product="vacuolar H+ ATPase E subunit"
                     /db_xref="GOA:P36543"
                     /db_xref="H-InvDB:HIT000323577.12"
                     /db_xref="HGNC:HGNC:857"
                     /db_xref="InterPro:IPR002842"
                     /db_xref="UniProtKB/Swiss-Prot:P36543"
                     /protein_id="CAA53814.1"
                     /translation="MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGR
                     LVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRL
                     SKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATK
                     NDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGA
                     NANRKFLD"
     regulatory      1243..1248
                     /regulatory_class="polyA_signal_sequence"
BASE COUNT          415 a          279 c          303 g          322 t
ORIGIN      
        1 ttgccgattt ctctcacctc acctttcaaa cctaaactcg agcctgctgt tcaccggcct
       61 agcattgctc tcgccatggc tctcagcgat gctgacgtgc aaaagcagat aaagcatatg
      121 atggctttca ttgaacaaga agccaatgag aaagcagaag aaatagatgc aaaggcagaa
      181 gaagagttca acatagagaa aggtcggctt gtgcaaaccc aaagactaaa gattatggaa
      241 tattatgaga agaaagagaa acagattgag cagcagaaga aaattcagat gtccaatttg
      301 atgaatcaag cgagactcaa agtcctcaga gcaagagatg accttatcac agacctacta
      361 aatgaagcaa aacagagact cagcaaggtg gtaaaagata caaccaggta ccaagtgctg
      421 ctggatggac tggttctcca gggtttgtac cagttgctgg agccccgaat gattgttcgt
      481 tgcaggaaac aagatttccc tctggtaaag gctgcagtgc agaaggcaat tcctatgtac
      541 aaaattgcca ccaaaaacga tgttgatgtc caaattgacc aggagtccta cctgcctgaa
      601 gacatagctg gtggagttga gatctataat ggagatcgta aaataaaggt ttccaacacc
      661 ctggaaagcc ggctggatct catagcccag cagatgatgc cagaagtccg gggagccttg
      721 tttggtgcaa atgccaacag gaagtttttg gactaagcct tcaggaggtg gagttcgtcg
      781 tcagctctcc tgctgtgatg tggaagcttc tgatatttga agaaacacga atgtctctgt
      841 agcttcctct tcactgcccc agtattgctc tgtatttatc agcgatgccc ctctgtcact
      901 catgccttgc ctaattgttc acaatggtgg aaagcttcat gtaatatgat caggacccac
      961 ctccagttct tctgaaagtg tgacagtgtc cagccggttc tgcagcacta ggggaggggg
     1021 caaatggtgg ttgcatgggc ttcctgggtc tccactctcc gtctggccta aaggtgatgt
     1081 atttggtgtt tggccctgca gtccccactc ttgaggctta aggcgcatgt ggcacaccac
     1141 tccttccagc agtagtcgct ttactgttac ctgtttaggc ctagaagttt tccctcatct
     1201 gtaaatgtga tttaaaatct aagccatgaa tatgctttat ttattaaaag agttatgcgg
     1261 aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaa
//