LOCUS       X70340                  4119 bp    mRNA    linear   HUM 07-DEC-1993
DEFINITION  H.sapiens mRNA for transforming growth factor alpha.
ACCESSION   X70340
VERSION     X70340.1
KEYWORDS    transforming growth factor alpha.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1
  AUTHORS   Qian J.F., Feingold J., Stoll C., May E.
  TITLE     Transforming growth factor-alpha: characterization of the BamHI,
            RsaI, and TaqI polymorphic regions
  JOURNAL   Am. J. Hum. Genet. 53(1), 168-175(1993).
   PUBMED   8100397
REFERENCE   2  (bases 1 to 4119)
  AUTHORS   May E.
  JOURNAL   Submitted (04-FEB-1993) to the INSDC. E. May, Lab d'Oncologie
            Moleculaire - IRSC-CNRS, 7 rue Guy Moquet, 94801 Villejuif Cedex,
            FRANCE
REFERENCE   3
  AUTHORS   Qian J.F., Lazar-Wesley E., Breugnot C., May E.
  TITLE     Human transforming growth factor alpha: sequence analysis of the
            4.5-kb and 1.6-kb mRNA species
  JOURNAL   Gene 132(2), 291-296(1993).
   PUBMED   8224876
FEATURES             Location/Qualifiers
     source          1..4119
                     /db_xref="H-InvDB:HIT000323098"
                     /organism="Homo sapiens"
                     /chromosome="2"
                     /map="2p13"
                     /mol_type="mRNA"
                     /cell_line="SW613S c13"
                     /cell_type="carcinoma"
                     /tissue_type="colon"
                     /db_xref="taxon:9606"
     CDS             32..514
                     /gene="TGFA"
                     /product="transforming growth factor alpha"
                     /db_xref="GOA:P01135"
                     /db_xref="H-InvDB:HIT000323098.15"
                     /db_xref="HGNC:HGNC:11765"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR013032"
                     /db_xref="InterPro:IPR015497"
                     /db_xref="PDB:1GK5"
                     /db_xref="PDB:1MOX"
                     /db_xref="PDB:1YUF"
                     /db_xref="PDB:1YUG"
                     /db_xref="PDB:2TGF"
                     /db_xref="PDB:3E50"
                     /db_xref="PDB:3TGF"
                     /db_xref="PDB:4TGF"
                     /db_xref="PDB:5KN5"
                     /db_xref="UniProtKB/Swiss-Prot:P01135"
                     /protein_id="CAA49806.1"
                     /translation="MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHF
                     NDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITA
                     LVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
                     "
     mat_peptide     149..298
                     /product="transforming growth factor alpha"
     polyA_site      1333..1338
                     /note="1.6 kb species"
     misc_feature    2796..2801
                     /note="BamHI polymorphic site"
     polyA_site      4069..4074
                     /note="4.5 kb species"
BASE COUNT         1122 a          897 c          916 g         1184 t
ORIGIN      
        1 ctggagagcc tgctgcccgc ccgcccgtaa aatggtcccc tcggctggac agctcgccct
       61 gttcgctctg ggtattgtgt tggctgcgtg ccaggccttg gagaacagca cgtccccgct
      121 gagtgcagac ccgcccgtgg ctgcagcagt ggtgtcccat tttaatgact gcccagattc
      181 ccacactcag ttctgcttcc atggaacctg caggtttttg gtgcaggagg acaagccagc
      241 atgtgtctgc cattctgggt acgttggtgc acgctgtgag catgcggacc tcctggccgt
      301 ggtggctgcc agccagaaga agcaggccat caccgccttg gtggtggtct ccatcgtggc
      361 cctggctgtc cttatcatca catgtgtgct gatacactgc tgccaggtcc gaaaacactg
      421 tgagtggtgc cgggccctca tctgccggca cgagaagccc agcgccctcc tgaagggaag
      481 aaccgcttgc tgccactcag aaacagtggt ctgaagagcc cagaggagga gtttggccag
      541 gtggactgtg gcagatcaat aaagaaaggc ttcttcagga cagcactgcc agagatgcct
      601 gggtgtgcca cagaccttcc tacttggcct gtaatcacct gtgcagcctt ttgtgggcct
      661 tcaaaactct gtcaagaact ccgtctgctt ggggttattc agtgtgacct agagaagaaa
      721 tcagcggacc acgatttcaa gacttgttaa aaaagaactg caaagagacg gactcctgtt
      781 cacctaggtg aggtgtgtgc agcagttggt gtctgagtcc acatgtgtgc agttgtcttc
      841 tgccagccat ggattccagg ctatatattt ctttttaatg ggccacctcc ccacaacaga
      901 attctgccca acacaggaga tttctatagt tattgttttc tgtcatttgc ctactgggga
      961 agaaagtgaa ggaggggaaa ctgtttaata tcacatgaag accctagctt taagagaagc
     1021 tgtatcctct aaccacgaga ctctcaacca gcccaacatc ttccatggac acatgacatt
     1081 gaagaccatc ccaagctatc gccacccttg gagatgatgt cttatttatt agatggataa
     1141 tggttttatt tttaatctct taagtcaatg taaaaagtat aaaacccctt cagacttcta
     1201 cattaatgat gtatgtgttg ctgactgaaa agctatactg attagaaatg tctggcctct
     1261 tcaagacagc taaggcttgg gaaaagtctt ccagggtgcg gagatggaac cagaggctgg
     1321 gttactggta ggaataaagg taggggttca gaaatggtgc cattgaagcc acaaagccgg
     1381 taaatgcctc aatacgttct gggagaaaac ttagcaaatc catcagcagg gatctgtccc
     1441 ctctgttggg gagagaggaa gagtgtgtgt gtctacacag gataaaccca atacatattg
     1501 tactgctcag tgattaaatg ggttcacttc ctcgtgagcc ctcggtaagt atgtttagaa
     1561 atagaacatt agccacgagc cataggcatt tcaggccaaa tccatgaaag ggggaccagt
     1621 catttatttt ccattttgtt gcttggttgg tttgttgctt tatttttaaa aggagaagtt
     1681 taactttgct atttattttc gagcactagg aaaactattc cagtaatttt tttttcctca
     1741 tttccattca ggatgccggc tttattaaca aaaactctaa caagtcacct ccactatgtg
     1801 ggtcttcctt tcccctcaag agaaggagca attgttcccc tgacatctgg gtccatctga
     1861 cccatggggc ctgcctgtga gaaacagtgg gtcccttcaa atacatagtg gatagctcat
     1921 ccctaggaat tttcattaaa atttggaaac agagtaatga agaaataata tataaactcc
     1981 ttatgtgagg aaatgctact aatatctgaa aagtgaaaga tttctatgta ttaactctta
     2041 agtgcaccta gcttattaca tcgtgaaagg tacatttaaa atatgttaaa ttggcttgaa
     2101 attttcagag aattttgtct tcccctaatt cttcttcctt ggtctggaag aacaatttct
     2161 atgaattttc tctttatttt ttttttataa ttcagacaat tctatgaccc gtgtcttcat
     2221 ttttggcact cttatttaac aatgccacac ctgaagcact tggatctgtt cagagctgac
     2281 cccctagcaa cgtagttgac acagctccag gtttttaaat tactaaaata agttcaagtt
     2341 tacatccctt gggccagata tgtgggttga ggcttgactg tagcatcctg cttagagacc
     2401 aatcaatgga cactggtttt tagacctcta tcaatcagta gttagcatcc aagagacttt
     2461 gcagaggcgt aggaatgagg ctggacagat ggcggaacga gaggttccct gcgaagactt
     2521 gagatttagt gtctgtgaat gttctagttc ctaggtccag caagtcacac ctgccagtgc
     2581 cctcatcctt atgcctgtaa cacacatgca gtgagaggcc tcacatatac gcctccctag
     2641 aagtgccttc caagtcagtc ctttggaaac cagcaggtct gaaaaagagg ctgcatcaat
     2701 gcaagcctgg ttggaccatt gtccatgcct caggatagaa cagcctggct tatttgggga
     2761 tttttcttct agaaatcaaa tgactgataa gcattggctc cctctgccat ttaatggcaa
     2821 tggtagtctt tggttagctg caaaaatact ccatttcaag ttaaaaatgc atcttctaat
     2881 ccatctctgc aagctccctg tgtttccttg ccctttagaa aatgaattgt tcactacaat
     2941 tagagaatca tttaacatcc tgacctggta agctgccaca cacctggcag tggggagcat
     3001 cgctgtttcc aatggctcag gagacaatga aaagccccca tttaaaaaaa taacaaacat
     3061 tttttaaaag gcctccaata ctcttatgga gcctggattt ttcccactgc tctacaggct
     3121 gtgacttttt ttaagcatcc tgacaggaaa tgttttcttc tacatggaaa gatagacagc
     3181 agccaaccct gatctggaag acagggcccc ggctggacac acgtggaacc aagccaggga
     3241 tgggctggcc attgtgtccc cgcaggagag atgggcagaa tggccctaga gttcttttcc
     3301 ctgagaaagg agaaaaagat gggattgcca ctcacccacc cacactggta agggaggaga
     3361 atttgtgctt ctggagcttc tcaagggatt gtgttttgca ggtacagaaa actgcctgtt
     3421 atcttcaagc caggttttcg agggcacatg ggtcaccagt tgctttttca gtcaatttgg
     3481 ccgggatgga ctaatgaggc tctaacactg ctcaggagac ccctgccctc tagttggttc
     3541 tgggctttga tctcttccaa cctgcccagt cacagaagga ggaatgactc aaatgcccaa
     3601 aaccaagaac acattgcaga agtaagacaa acatgtatat ttttaaatgt tctaacataa
     3661 gacctgttct ctctagccat tgatttacca ggctttctga aagatctagt ggttcacaca
     3721 gagagagaga gagtactgaa aaagcaactc ctcttcttag tcttaataat ttactaaaat
     3781 ggtcaacttt tcattatctt tattataata aacctgatgc ttttttttag aactccttac
     3841 tctgatgtct gtatatgttg cactgaaaag gttaatattt aatgttttaa tttattttgt
     3901 gtggtaagtt aattttgatt tctgtaatgt gttaatgtga ttagcagtta ttttccttaa
     3961 tatctgaatt atacttaaag agtagtgagc aatataagac gcaattgtgt ttttcagtaa
     4021 tgtgcattgt tattgagttg tactgtacct tatttggaag gatgaaggaa tgaacctttt
     4081 tttcctaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaa
//