LOCUS       X67155                  3348 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens mRNA for mitotic kinesin-like protein-1 (MKLP-1 gene).
ACCESSION   X67155 S46300
VERSION     X67155.2
KEYWORDS    ATPase; kinesin-like protein; microtubule-associated protein;
            mitotic protein; MKLP-1 gene.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1
  AUTHORS   Nislow,C.E.
  JOURNAL   Submitted (03-JUL-1992) to the INSDC. C.E. Nislow, University of
            Colorado at Boulder, Dept MCD Biology, Campus Box 347, Boulder CO
            80309, USA
  REMARK    revised by [5]
REFERENCE   2  (bases 1 to 3258)
  AUTHORS   Nislow,C., Lombillo,V.A., Kuriyama,R. and  McIntosh,J.R.
  TITLE     A plus-end-directed motor enzyme that moves antiparallel
            microtubules in vitro localizes to the interzone of mitotic
            spindles
  JOURNAL   Nature 359(6395), 543-547(1992).
   PUBMED   1406973
REFERENCE   4  (bases 1 to 3348)
  AUTHORS   Gryka,M.A., Shiekhattar,R., Nigg,E. and  McIntosh,J.R.
  JOURNAL   Unpublished.
REFERENCE   5  (bases 1 to 3348)
  AUTHORS   Gryka,M.A.
  JOURNAL   Submitted (13-JAN-2000) to the INSDC. M.A. Gryka, c/o R.I.
            McIntosh, University of Colorado at Boulder, Dept MCD Biology,
            Campus Box 347, Boulder CO 80309, USA
FEATURES             Location/Qualifiers
     source          1..3348
                     /db_xref="H-InvDB:HIT000322856"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /cell_type="HeLa cells"
                     /db_xref="taxon:9606"
     CDS             61..2631
                     /gene="MKLP-1"
                     /product="mitotic kinase-like protein-1"
                     /db_xref="GOA:Q02241"
                     /db_xref="H-InvDB:HIT000322856.12"
                     /db_xref="HGNC:HGNC:6392"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="PDB:3VHX"
                     /db_xref="UniProtKB/Swiss-Prot:Q02241"
                     /protein_id="CAA47628.2"
                     /translation="MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCI
                     EVINNTTVQLHTPEGYRLNRNGDYKETQYSFKQVFGTHTTQKELFDVVANPLVNDLIH
                     GKNGLLFTYGVTGSGKTHTMTGSPGEGGLLPRCLDMIFNSIGSFQAKRYVFKSNDRNS
                     MDIQCEVDALLERQKREAMPNPKTSSSKRQVDPEFADMITVQEFCKAEEVDEDSVYGV
                     FVSYIEIYNNYIYDLLEEVPFDPIKPKPPQSKLLREDKNHNMYVAGCTEVEVKSTEEA
                     FEVFWRGQKKRRIANTHLNRESSRSHSVFNIKLVQAPLDADGDNVLQEKEQITISQLS
                     LVDLAGSERTNRTRAEGNRLREAGNINQSLMTLRTCMDVLRENQMYGTNKMVPYRDSK
                     LTHLFKNYFDGEGKVRMIVCVNPKAEDYEENLQVMRFAEVTQEVEVARPVDKAICGLT
                     PGRRYRNQPRGPVGNEPLVTDVVLQSFPPLPSCEILDINDEQTLPRLIEALEKRHNLR
                     QMMIDEFNKQSNAFKALLQEFDNAVLSKENHMQGKLNEKEKMISGQKLEIERLEKKNK
                     TLEYKIEILEKTTTIYEEDKRNLQQELETQNQKLQRQFSDKRRLEARLQGMVTETTMK
                     WEKECERRVAAKQLEMQNKLWVKDEKLKQLKAIVTEPKTEKPERPSRERDREKVTQRS
                     VSPSPVPLLFQPDQNAPPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPHAITV
                     SVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETLKQES
                     PNGSRKRRSSTVAPAQPDGAESEWTDVETRCSVAVEMRAGSQLGPGYQHHAQPKRKKP
                     "
BASE COUNT         1126 a          628 c          729 g          865 t
ORIGIN
        1 gtactcctca accactctcc taatgattgg aacaaaagaa aaaaaaagaa aaaaaaagcc
       61 atgaagtcag cgagagctaa gacaccccgg aaacctaccg tgaaaaaagg gtcccaaacg
      121 aaccttaaag acccagttgg ggtatactgt agggtgcgcc cactgggctt tcctgatcaa
      181 gagtgttgca tagaagtgat caataataca actgttcagc ttcatactcc tgagggctac
      241 agactcaacc gaaatggaga ctataaggag actcagtatt catttaaaca agtatttggc
      301 actcacacca cccagaagga actctttgat gttgtggcta atcccttggt caatgacctc
      361 attcatggca aaaatggtct tctttttaca tatggtgtga cgggaagtgg aaaaactcac
      421 acaatgactg gttctccagg ggaaggaggg ctgcttcctc gttgtttgga catgatcttt
      481 aacagtatag ggtcatttca agctaaacga tatgttttca aatctaatga taggaatagt
      541 atggatatac agtgtgaggt tgatgcctta ttagaacgtc agaaaagaga agctatgccc
      601 aatccaaaga cttcttctag caaacgacaa gtagatccag agtttgcaga tatgataact
      661 gtacaagaat tctgcaaagc agaagaggtt gatgaagata gtgtctatgg tgtatttgtc
      721 tcttatattg aaatatataa taattacata tatgatctat tggaagaggt gccgtttgat
      781 cccataaaac ccaaacctcc acaatctaaa ttgcttcgtg aagataagaa ccataacatg
      841 tatgttgcag gatgtacaga agttgaagtg aaatctactg aggaggcttt tgaagttttc
      901 tggagaggcc agaaaaagag acgtattgct aatacccatt tgaatcgtga gtccagccgt
      961 tcccatagcg tgttcaacat taaattagtt caggctccct tggatgcaga tggagacaat
     1021 gtcttacagg aaaaagaaca aatcactata agtcagttgt ccttggtaga tcttgctgga
     1081 agtgaaagaa ctaaccggac cagagcagaa gggaacagat tacgtgaagc tggtaatatt
     1141 aatcagtcac taatgacgct aagaacatgt atggatgtcc taagagagaa ccaaatgtat
     1201 ggaactaaca agatggttcc atatcgagat tcaaagttaa cccatctgtt caagaactac
     1261 tttgatgggg aaggaaaagt gcggatgatc gtgtgtgtga accccaaggc tgaagattat
     1321 gaagaaaact tgcaagtcat gagatttgcg gaagtgactc aagaagttga agtagcaaga
     1381 cctgtagaca aggcaatatg tggtttaacg cctgggagga gatacagaaa ccagcctcga
     1441 ggtccagttg gaaatgaacc attggttact gacgtggttt tgcagagttt tccacctttg
     1501 ccgtcatgcg aaattttgga tatcaacgat gagcagacac ttccaaggct gattgaagcc
     1561 ttagagaaac gacataactt acgacaaatg atgattgatg agtttaacaa acaatctaat
     1621 gcttttaaag ctttgttaca agaatttgac aatgctgttt taagtaaaga aaaccacatg
     1681 caagggaaac taaatgaaaa ggagaagatg atctcaggac agaaattgga aatagaacga
     1741 ctggaaaaga aaaacaaaac tttagaatat aagattgaga ttttagagaa aacaactact
     1801 atctatgagg aagataaacg caatttgcaa caggaacttg aaactcagaa ccagaaactt
     1861 cagcgacagt tttctgacaa acgcagatta gaagccaggt tgcaaggcat ggtgacagaa
     1921 acgacaatga agtgggagaa agaatgtgag cgtagagtgg cagccaaaca gctggagatg
     1981 cagaataaac tctgggttaa agatgaaaag ctgaaacaac tgaaggctat tgttactgaa
     2041 cctaaaactg agaagccaga gagaccctct cgggagcgag atcgagaaaa agttactcaa
     2101 agatctgttt ctccatcacc tgtgccttta ctctttcaac ctgatcagaa cgcaccacca
     2161 attcgtctcc gacacagacg atcacgctct gcaggagaca gatgggtaga tcataagccc
     2221 gcctctaaca tgcaaactga aacagtcatg cagccacatg tccctcatgc catcacagta
     2281 tctgttgcaa atgaaaaggc actagctaag tgtgagaagt acatgctgac ccaccaggaa
     2341 ctagcctccg atggggagat tgaaactaaa ctaattaagg gtgatattta taaaacaagg
     2401 ggtggtggac aatctgttca gtttactgat attgagactt taaagcaaga atcaccaaat
     2461 ggtagtcgaa aacgaagatc ttccacagta gcacctgccc aaccagatgg tgcagagtct
     2521 gaatggaccg atgtagaaac aaggtgttct gtggctgtgg agatgagagc aggatcccag
     2581 ctgggacctg gatatcagca tcacgcacaa cccaagcgca aaaagccatg aactgacagt
     2641 cccagtactg aaagaacatt ttcatttgtg tggatgattt ctcgaaagcc atgccagaag
     2701 cagtcttcca ggtcatcttg tagaactcca gctttgttga aaatcacgga cctcagctac
     2761 atcatacact gacccagagc aaagctttcc ctatggttca aagacaacta gtattcaaca
     2821 aaccttgtat agtgtatgtt ttgccatatt taatattaat agcagaggaa gactcctttt
     2881 ttcatcactg tatgaatttt ttataatgtt tttttaaaat atatttcatg tatacttata
     2941 aactaattca cacaagtgtt tgtcttagat gattaaggaa gactatatct agatcatgtc
     3001 tgatttttta ttgtgacttc tccagccctg gtctgaattt cttaaggttt tataaacaaa
     3061 tgctgctatt tattagctgc aagaatgcac tttagaacta tttgacaatt cagactttca
     3121 aaataaagat gtaaatgact ggccaataat aaccatttta ggaaggtgtt ttgaattctg
     3181 tatgtatata ttcactttct gacatttaga tatgccaaaa gaattaaaat caaaagcgga
     3241 attcctgcag cccgggggat ccactagttc tagagcggcc gccaccgcgg tggagctcca
     3301 gcttttgttc cctttagtga gggttaattt cgagcttggc gtaatcat
//