LOCUS       X66403                  2457 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  H.sapiens mRNA for acetylcholine receptor (epsilon subunit).
ACCESSION   X66403
VERSION     X66403.1
KEYWORDS    acetylcholine receptor.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1
  AUTHORS   Beeson,D.M.W.
  JOURNAL   Submitted (25-MAY-1992) to the INSDC. D.M.W. Beeson, Institute of
            Molecular Medicine, Neurosciences group, Inst. of Mol. Med., John
            Radcliffe Hospital, Headington, Oxford OX3 9DU, UK
  REMARK    revised by [3]   MAT
REFERENCE   2
  AUTHORS   Beeson,D.M.W., Brydson,M., Betty,M., Jeremiah,S., Povey,S.,
            Vincent,A. and  Newsom-Davis,J.
  TITLE     Primary structure of the human muscle acetylcholine receptor. cDNA
            cloning of the gamma and epsilon subunits
  JOURNAL   Eur. J. Biochem. 215(2), 229-238(1993).
   PUBMED   7688301
REFERENCE   3  (bases 1 to 2457)
  AUTHORS   Beeson,D.M.W.
  JOURNAL   Submitted (25-OCT-1994) to the INSDC. D.M.W. Beeson, Institute of
            Molecular Medicine, Neurosciences group, Inst. of Mol. Med., John
            Radcliffe Hospital, Headington, Oxford OX3 9DU, UK
FEATURES             Location/Qualifiers
     source          1..2457
                     /db_xref="H-InvDB:HIT000322830"
                     /organism="Homo sapiens"
                     /chromosome="17 CHRNE"
                     /mol_type="mRNA"
                     /dev_stage="adult"
                     /clone_lib="lambda gt11 muscle cDNA"
                     /clone="RP3L, LMP8, RG1, RA6"
                     /cell_type="fibroblast"
                     /tissue_type="muscle"
                     /db_xref="taxon:9606"
     sig_peptide     12..72
                     /note="acetylcholine receptor epsilon  subunit-precursor"
     CDS             12..1493
                     /product="acetylcholine receptor epsilon subunit  CHRNE"
                     /db_xref="GOA:Q04844"
                     /db_xref="H-InvDB:HIT000322830.14"
                     /db_xref="HGNC:HGNC:1966"
                     /db_xref="InterPro:IPR002394"
                     /db_xref="InterPro:IPR006029"
                     /db_xref="InterPro:IPR006201"
                     /db_xref="InterPro:IPR006202"
                     /db_xref="InterPro:IPR018000"
                     /db_xref="InterPro:IPR027361"
                     /db_xref="PDB:2DF9"
                     /db_xref="UniProtKB/Swiss-Prot:Q04844"
                     /protein_id="CAA47030.1"
                     /translation="MARAPLGVLLLLGLLGRGVGKNEELRLYHHLFNNYDPGSRPVRE
                     PEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPS
                     ELVWLPEIVLENNIDGQFGVAYDANVLVYEGGSVTWLPPAIYRSVCAVEVTYFPFDWQ
                     NCSLIFRSQTYNAEEVEFTFAVDNDGKTINKIDIDTEAYTENGEWAIDFCPGVIRRHH
                     GGATDGPGETDVIYSLIIRRKPLFYVINIIVPCVLISGLVLLAYFLPAQAGGQKCTVS
                     INVLLAQTVFLFLIAQKIPETSLSVPLLGRFLIFVMVVATLIVMNCVIVLNVSQRTPT
                     THAMSPRLRHVLLELLPRLLGSPPPPEAPRAASPPRRASSVGLLLRAEELILKKPRSE
                     LVFEGQRHRQGTWTAAFCQSLGAAAPEVRCCVDAVNFVAESTRDQEATGEEVSDWVRM
                     GNALDNICFWAALVLFSVGSSLIFLGAYFNRVPDLPYAPCIQP"
     mat_peptide     73..1490
                     /product="acetylcholine receptor epsilon subunit  CHRNE"
BASE COUNT          477 a          751 c          703 g          526 t
ORIGIN
        1 cacgcagcag gatggcaagg gctccgcttg gggtcctgct cctcttgggg cttctcggca
       61 ggggtgtggg gaagaacgag gaactgcgtc tttatcacca tctcttcaac aactatgacc
      121 caggaagccg gccagtgcgg gagcctgagg atactgtcac catcagcctc aaggtcaccc
      181 tgacgaatct catctcactg aatgaaaaag aggagactct caccactagc gtctggattg
      241 gaatcgattg gcaggattac cgactcaact acagcaagga cgactttggg ggtatagaaa
      301 ccctgcgagt cccttcagaa ctcgtgtggc tgccagagat tgtgctggaa aacaatattg
      361 atggccagtt cggagtggcc tacgacgcca acgtgctcgt ctacgagggc ggctccgtga
      421 cgtggctgcc tccggccatc taccgcagcg tctgcgcagt ggaggtcacc tacttcccct
      481 tcgattggca gaactgttcg cttattttcc gctctcagac gtacaatgcc gaagaggtgg
      541 agttcacttt tgccgtagac aacgacggca agaccatcaa caagatcgac atcgacacag
      601 aggcctatac tgagaacggc gagtgggcca tcgacttctg cccgggggtg atccgccgcc
      661 accacggtgg cgccaccgac ggcccagggg agactgacgt catctactcg ctcatcatcc
      721 gccggaagcc gctcttctac gtcattaaca tcatcgtgcc ctgtgtgctc atctcgggcc
      781 tggtgctgct cgcctacttc ctgccggcgc aggccggcgg ccagaaatgc acggtctcca
      841 tcaacgtcct gctcgcccag accgtcttct tgttcctcat tgcccagaaa atcccagaga
      901 cttctctgag cgtgccgctc ctgggcaggt tccttatttt cgtcatggtg gtcgccacgc
      961 tcattgtcat gaattgcgtc atcgtgctca acgtgtccca gcggacgccc accacccacg
     1021 ccatgtcccc gcggctgcgc cacgttctcc tggagctgct gccgcgcctc ctgggctccc
     1081 cgccgccgcc cgaggccccc cgggccgcct cgcccccaag gcgggcgtcg tcggtgggct
     1141 tattgctccg cgcggaggag ctgatactga aaaagccacg gagcgagctc gtgtttgagg
     1201 ggcagaggca ccggcagggg acctggacgg ctgccttctg ccagagcctg ggcgccgccg
     1261 cccccgaggt ccgctgctgt gtggatgccg tgaacttcgt ggccgagagc acgagagatc
     1321 aggaggccac cggcgaggaa gtgtccgact gggtgcgcat ggggaatgcc cttgacaaca
     1381 tctgcttctg ggccgctctg gtgctcttca gcgtgggctc cagcctcatc ttcctcgggg
     1441 cctacttcaa ccgagtgcct gatctcccct acgcgccgtg tatccagcct tagctcgcac
     1501 cgacttcaat ttcccaccca tctccagtag gaaattgatt ttgaaaaagt aggctgccgc
     1561 caccacggca ttatgatccc ttccccctgc tgatcaatct gcagtttgtg aacttcacaa
     1621 gaatggtgtg tgcccgttcc ctggcgtgtg taggcctggc cgcagtccag gggtcagcag
     1681 gaggaaaggg ttcacatagg ctctcaggtg ccagtcttcc agaaagcaag gactgccctt
     1741 cattcagcct tgctgacctc ccagcctttc taaggctcag ccccacggga ctctggtggc
     1801 tgccagcttg tgagctatct atctatattc atttcatagc caaacaggag acccctttgc
     1861 aggacttgca cacagggagg ctgtagccag gaaaccctct tcttccctgg tctggctctg
     1921 ctggagcggg tgggaaccaa acaccttcag tgctggtggc cctcaggccc acaggtttaa
     1981 ggctgaggct gccctgaccc ttccacagtc atttcttcta ggttttcttg gcccagcact
     2041 gcccatccca ccccatgagg ctcactcatt gcagatccca gcccaccctg cccctttctt
     2101 ccccaccctg gaggctctct ctgcctagtc tacagtactg acagaaagca aggacatgcg
     2161 gcctgcatgg tgggagctgg ttgaattgtc tttattaaca aacaggatat ccaaggccac
     2221 tacattgagg aggggggagg ggggagggag gagaagggtt acttgctgct cacactatat
     2281 acagatgcaa gcaaggggcg tggagagtga gggctccctg ctccctccct ccaccgggga
     2341 agggcatggg ctagaagagg agaggggggt cgggaatggg gggaatgttt tggctgcggg
     2401 gtcccccctc cattccctgg agtttggggg aaggggaatc attaaagtgc tttcaga
//