LOCUS       X61969                  1244 bp    mRNA    linear   HUM 18-APR-2005
DEFINITION  H.sapiens mRNA for macropain subunit nu.
ACCESSION   X61969
VERSION     X61969.1
KEYWORDS    macropain.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1244)
  AUTHORS   DeMartino G.N., Orth K., McCullough M.L., Lee L.W., Munn T.Z.,
            Moomaw C.R., Dawson P.A., Slaughter C.A.
  TITLE     The primary structures of four subunits of the human,
            high-molecular-weight proteinase, macropain (proteasome), are
            distinct but homologous
  JOURNAL   Biochim. Biophys. Acta 1079(1), 29-38(1991).
   PUBMED   1888762
FEATURES             Location/Qualifiers
     source          1..1244
                     /db_xref="H-InvDB:HIT000322496"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             106..897
                     /product="macropaine subunit nu"
                     /db_xref="GOA:P25786"
                     /db_xref="H-InvDB:HIT000322496.12"
                     /db_xref="HGNC:HGNC:9530"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="PDB:4R3O"
                     /db_xref="PDB:4R67"
                     /db_xref="PDB:5A0Q"
                     /db_xref="PDB:5GJQ"
                     /db_xref="PDB:5GJR"
                     /db_xref="PDB:5L4G"
                     /db_xref="PDB:5LE5"
                     /db_xref="PDB:5LEX"
                     /db_xref="PDB:5LEY"
                     /db_xref="PDB:5LEZ"
                     /db_xref="PDB:5LF0"
                     /db_xref="PDB:5LF1"
                     /db_xref="PDB:5LF3"
                     /db_xref="PDB:5LF4"
                     /db_xref="PDB:5LF6"
                     /db_xref="PDB:5LF7"
                     /db_xref="PDB:5T0C"
                     /db_xref="PDB:5T0G"
                     /db_xref="PDB:5T0H"
                     /db_xref="PDB:5T0I"
                     /db_xref="PDB:5T0J"
                     /db_xref="UniProtKB/Swiss-Prot:P25786"
                     /protein_id="CAA43961.1"
                     /translation="MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHA
                     VLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRP
                     LPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMS
                     IGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKD
                     LEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH"
BASE COUNT          379 a          243 c          264 g          358 t
ORIGIN      
        1 ggaaactccc gcagacttct ctgtagatcg ctgagcgata ctttcggcag cacctccttg
       61 attctcagtt ttgctggagg ccgcaaccag gcccgcgccg ccaccatgtt tcgaaatcag
      121 tatgacaatg atgtcactgt ttggagcccc cagggcagga ttcatcaaat tgaatatgca
      181 atggaagctg ttaaacaagg ttcagccaca gttggtctga aatcaaaaac tcatgcagtt
      241 ttggttgcat tgaaaagggc gcaatcagag cttgcagctc atcagaaaaa aattctccat
      301 gttgacaacc acattggtat ctcaattgcg gggcttactg ctgatgctag actgttatgt
      361 aattttatgc gtcaggagtg tttggattcc agatttgtat tcgatagacc actgcctgtg
      421 tctcgtcttg tatctctaat tggaagcaag acccagatac caacacaacg atatggccgg
      481 agaccatatg gtgttggtct ccttattgct ggttatgatg atatgggccc tcacattttc
      541 caaacctgtc catctgctaa ctattttgac tgcagagcca tgtccattgg agcccgttcc
      601 caatcagctc gtacttactt ggagagacat atgtctgaat ttatggagtg taatttaaat
      661 gaactagtta aacatggtct gcgtgcctta agagagacgc ttcctgcaga acaggacctg
      721 actacaaaga atgtttccat tggaattgtt ggtaaagact tggagtttac aatctatgat
      781 gatgatgatg tgtctccatt cctggaaggt cttgaagaaa gaccacagag aaaggcacag
      841 cctgctcaac ctgctgatga acctgcagaa aaggctgatg aaccaatgga acattaagtg
      901 ataagccagt ctatatatgt attatcaaat atgtaagaat acaggcacca catactgatg
      961 acaataatct atactttgaa ccaaaagttg cagagtggtg gaatgctatg ctatgtttta
     1021 ggaatcagtc cagatgtgag ttttttccaa gcaacctcac tgaaacctat ataatggaat
     1081 acatttttct ttgaaagggt ctgtataatc attttctaga agtatgggta tctatactaa
     1141 tgttttttat ataagaacat aggtgtcttt gtggttttaa agacaactgt gaaataaaat
     1201 tgtttcaccg cctggtaaaa aaaaaaaaaa aaaaaaaaaa aaaa
//