LOCUS       X57110                  3090 bp    mRNA    linear   HUM 12-DEC-1992
DEFINITION  Human mRNA for c-cbl proto-oncogene.
ACCESSION   X57110
VERSION     X57110.1
KEYWORDS    cbl oncogene; nuclear protein; oncogene cellular.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3090)
  AUTHORS   Langdon W.Y.
  JOURNAL   Submitted (02-JAN-1991) to the INSDC. W.Y. Langdon, INSTITUTE OF
            MEDICAL & VETERINARY SCIENE, IMVS, DIVISION OF HUMAN IMMUNOLOGY,
            BOX 14 RUNDEL MALL POST OFFICE, ADELAIDE SA 5000, AUSTRALIA
REFERENCE   2
  AUTHORS   Langdon W.Y.
  JOURNAL   Submitted (01-JAN-1991) to the INSDC. Langdon W.Y., Institute of
            Medical und Veterinary, Sciene, IMVS, Division of Human Immunology,
            Box 14 Rundel Mall Post Office, Adelaide SA 5000, Australia.
REFERENCE   3
  AUTHORS   Blake T.S., Shapiro M., Morse III M.C., Langdon W.Y.
  TITLE     The sequences of the human and mouse c-cbl proto-oncogenes show
            v-cbl was generated by a large truncation encompassing a
            proline-rich domain and a leucine zipper-like motif
  JOURNAL   Oncogene 6(4), 653-657(1991).
   PUBMED   2030914
REFERENCE   4  (bases 1 to 3090)
  AUTHORS   Blake T.J., Langdon W.Y.
  TITLE     A rearrangement of the c-cbl proto-oncogene in HUT78 T-lymphoma
            cells results in a truncated protein
  JOURNAL   Oncogene 7(4), 757-762(1992).
   PUBMED   1565471
FEATURES             Location/Qualifiers
     source          1..3090
                     /db_xref="H-InvDB:HIT000322065"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     mRNA            1..3090
                     /gene="c-cbl"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             149..2869
                     /gene="c-cbl"
                     /note="c-cbl protein"
                     /db_xref="GOA:P22681"
                     /db_xref="H-InvDB:HIT000322065.13"
                     /db_xref="HGNC:HGNC:1541"
                     /db_xref="InterPro:IPR000980"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003153"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014741"
                     /db_xref="InterPro:IPR014742"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR024159"
                     /db_xref="InterPro:IPR024162"
                     /db_xref="PDB:1B47"
                     /db_xref="PDB:1FBV"
                     /db_xref="PDB:1YVH"
                     /db_xref="PDB:2CBL"
                     /db_xref="PDB:2JUJ"
                     /db_xref="PDB:2K4D"
                     /db_xref="PDB:2OO9"
                     /db_xref="PDB:2Y1M"
                     /db_xref="PDB:2Y1N"
                     /db_xref="PDB:3BUM"
                     /db_xref="PDB:3BUN"
                     /db_xref="PDB:3BUO"
                     /db_xref="PDB:3BUW"
                     /db_xref="PDB:3BUX"
                     /db_xref="PDB:3OB1"
                     /db_xref="PDB:3OB2"
                     /db_xref="PDB:3PLF"
                     /db_xref="PDB:4A49"
                     /db_xref="PDB:4A4B"
                     /db_xref="PDB:4A4C"
                     /db_xref="PDB:4GPL"
                     /db_xref="UniProtKB/Swiss-Prot:P22681"
                     /protein_id="CAA40393.1"
                     /translation="MAGNVKKSSGAGGGTGSGGSGSGGLIGLMKDAFQPHHHHHHHLS
                     PHPPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRY
                     EGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSH
                     MLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSG
                     LEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDE
                     VKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFRE
                     GFYLFPDGRNQNPDLTGLCEPTPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVK
                     IEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDPFDPRGSGSLLRQGAEGA
                     PSPNYDDDDDERADDTLFMMKELAGAKVERPPSPFSMAPQASLPPVPPRLDLLPQRVC
                     VPSSASALGTASKAASGSLHKDKPLPVPPTLRDLPPPPPPDRPYSVGAESRPQRRPLP
                     CTPGDCPSRDKLPPVPSSRLGDSWLPRPIPKVPVSAPSSSDPWTGRELTNRHSLPFSL
                     PSQMEPRPDVPRLGSTFSLDTSMSMNSSPLVGPECDHPKIKPSSSANAIYSLAARPLP
                     VPKLPPGEQCEGEEDTEYMTPSSRPLRPLDTSQSSRACDCDQQIDSCTYEAMYNIQSQ
                     APSITESSTFGEGNLAAAHANTGPEESENEDDGYDVPKPPVPAVLARRTLSDISNASS
                     SFGWLSLDGDPTTNVTEGSQVPERPPKPFPRRINSERKAGSCQQGSGPAASAATASPQ
                     LSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSPAHVAT"
BASE COUNT          757 a          840 c          764 g          729 t
ORIGIN      
        1 gaattccggg cccggatagc cggcggcggc ggcggcggcg gcggcggcgg cggccgggag
       61 aggcccctcc ttcacgccct gcttctctcc ctcgctcgca gtcgagccga gccggcggac
      121 ccgcctgggc tccgaccctg cccaggccat ggccggcaac gtgaagaaga gctctggggc
      181 cgggggcggc acgggctccg ggggctcggg ttcgggtggc ctgattgggc tcatgaagga
      241 cgccttccag ccgcaccacc accaccacca ccacctcagc ccccacccgc cggggacggt
      301 ggacaagaag atggtggaga agtgctggaa gctcatggac aaggtggtgc ggttgtgtca
      361 gaacccaaag ctggcgctaa agaatagccc accttatatc ttagacctgc taccagatac
      421 ctaccagcat ctccgtacta tcttgtcaag atatgagggg aagatggaga cacttggaga
      481 aaatgagtat tttagggtgt ttatggagaa tttgatgaag aaaactaagc aaaccataag
      541 cctcttcaag gagggaaaag aaagaatgta tgaggagaat tctcagccta ggcgaaacct
      601 aaccaaactg tccctcatct tcagccacat gctggcagaa ctaaaaggaa tctttccaag
      661 tggactcttt cagggagaca catttcggat tactaaagca gatgctgcgg aattttggag
      721 aaaagctttt ggggaaaaga caatagtccc ttggaagagc tttcgacagg ctctacatga
      781 agtgcatccc atcagttctg ggctggaggc catggctctg aaatccacta ttgatctgac
      841 ctgcaatgat tatatttcgg tttttgaatt tgacatcttt acccgactct ttcagccctg
      901 gtcctctttg ctcaggaatt ggaacagcct tgctgtaact catcctggct acatggcttt
      961 tttgacgtat gacgaagtga aagctcggct ccagaaattc attcacaaac ctggcagtta
     1021 tatcttccgg ctgagctgta ctcgtctggg tcagtgggct attgggtatg ttactgctga
     1081 tgggaacatt ctccagacaa tccctcacaa taaacctctc ttccaagcac tgattgatgg
     1141 cttcagggaa ggcttctatt tgtttcctga tggacgaaat cagaatcctg atctgactgg
     1201 cttatgtgaa ccaactcccc aagaccatat caaagtgacc caggaacaat atgaattata
     1261 ctgtgagatg ggctccacat tccaactatg taaaatatgt gctgaaaatg ataaggatgt
     1321 aaagattgag ccctgtggac acctcatgtg cacatcctgt cttacatcct ggcaggaatc
     1381 agaaggtcag ggctgtcctt tctgccgatg tgaaattaaa ggtactgaac ccatcgtggt
     1441 agatccgttt gatcctagag ggagtggcag cctgttgagg caaggagcag agggagctcc
     1501 ctccccaaat tatgatgatg atgatgatga acgagctgat gatactctct tcatgatgaa
     1561 ggaattggct ggtgccaagg tggaacggcc gccttctcca ttctccatgg ccccacaagc
     1621 ttcccttccc ccggtgccac cacgacttga ccttctgccg cagcgagtat gtgttccctc
     1681 aagtgcttct gctcttggaa ctgcttctaa ggctgcttct ggctcccttc ataaagacaa
     1741 accattgcca gtacctccca cacttcgaga tcttccacca ccaccgcctc cagaccggcc
     1801 atattctgtt ggagcagaat cccgacctca aagacgcccc ttgccttgta caccaggcga
     1861 ctgtccctcc agagacaaac tgccccctgt cccctctagc cgccttggag actcatggct
     1921 gccccggcca atccccaaag taccagtatc tgccccaagt tccagtgatc cctggacagg
     1981 aagagaatta accaaccggc actcacttcc attttcattg ccctcacaaa tggagcccag
     2041 accagatgtg cctaggctcg gaagcacgtt cagtctggat acctccatga gtatgaatag
     2101 cagcccatta gtaggtccag agtgtgacca ccccaaaatc aaaccttcct catctgccaa
     2161 tgccatttat tctctggctg ccagacctct tcctgtgcca aaactgccac ctggggagca
     2221 atgtgagggt gaagaggaca cagagtacat gactccctct tccaggcctc tacggccttt
     2281 ggatacatcc cagagttcac gagcatgtga ttgcgaccag cagattgata gctgtacgta
     2341 tgaagcaatg tataatattc agtcccaggc gccatctatc accgagagca gcacctttgg
     2401 tgaagggaat ttggccgcag cccatgccaa cactggtccc gaggagtcag aaaatgagga
     2461 tgatgggtat gatgtcccaa agccacctgt gccggccgtg ctggcccgcc gaactctctc
     2521 agatatctct aatgccagct cctcctttgg ctggttgtct ctggatggtg atcctacaac
     2581 aaatgtcact gaaggttccc aagttcccga gaggcctcca aaaccattcc cgcggagaat
     2641 caactctgaa cggaaagctg gcagctgtca gcaaggtagt ggtcctgccg cctctgctgc
     2701 caccgcctca cctcagctct ccagtgagat cgagaacctc atgagtcagg ggtactccta
     2761 ccaggacatc cagaaagctt tggtcattgc ccagaacaac atcgagatgg ccaaaaacat
     2821 cctccgggaa tttgtttcca tttcttctcc tgcccatgta gctacctagc acaccatctc
     2881 cctgctgcag gtttagagga ccagtgagtt gggagttatt actcaagtgg cacctagaag
     2941 ggcaggagtt cctttggtga cttcacagtg aagtcttgcc ctctctgtgg gatatcacat
     3001 cagtggttcc aagatttcaa agtggtgaaa tgaaaatgga gcagctagta tgttttatta
     3061 ttttatgggt cttgagtgca tttgaaggtg
//