LOCUS       X52611                  1636 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Human mRNA for transcription factor AP-2.
ACCESSION   X52611 Y00229
VERSION     X52611.1
KEYWORDS    DNA-binding protein; transcription factor; transcription factor
            AP-2.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1636)
  AUTHORS   Williams,T.J.
  JOURNAL   Submitted (07-APR-1990) to the INSDC. Williams T.J., University of
            California, Dept of Biochemistry, Berkeley California 94720, U S A.
REFERENCE   2  (bases 1 to 1636)
  AUTHORS   Williams,T., Admon,A., Luescher,B. and  Tjian,R.
  TITLE     Cloning and expression of AP-2, a cell-type-specific transcription
            factor that activates inducible enhancer elements
  JOURNAL   Genes Dev. 2(12A), 1557-1569(1988).
   PUBMED   3063603
COMMENT     Data kindly reviewed (08-AUG-1990) by T. Williams.
FEATURES             Location/Qualifiers
     source          1..1636
                     /db_xref="H-InvDB:HIT000321786"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /cell_line="HeLa"
                     /db_xref="taxon:9606"
     CDS             63..1376
                     /note="transcription factor AP-2 (AA 1-437)"
                     /db_xref="GOA:P05549"
                     /db_xref="H-InvDB:HIT000321786.11"
                     /db_xref="HGNC:HGNC:11742"
                     /db_xref="InterPro:IPR004979"
                     /db_xref="InterPro:IPR008121"
                     /db_xref="InterPro:IPR013854"
                     /db_xref="UniProtKB/Swiss-Prot:P05549"
                     /protein_id="CAA36842.1"
                     /translation="MLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPP
                     LSHTPNADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQS
                     QESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVP
                     HVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRL
                     SLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNL
                     PAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTR
                     KNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVC
                     AAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK"
BASE COUNT          369 a          594 c          402 g          271 t
ORIGIN
        1 gaattccggc tctctgggtg agagaccgag aggggcatat ccgttcacgc cgatccatga
       61 aaatgctttg gaaattgacg gataatatca agtacgagga ctgcgaggac cgtcacgacg
      121 gcaccagcaa cgggacggca cggttgcccc agctgggcac tgtaggtcaa tctccctaca
      181 cgagcgcccc gccgctgtcc cacaccccca atgccgactt ccagccccca tacttccccc
      241 caccctacca gcctatctac ccccagtcgc aagatcctta ctcccacgtc aacgacccct
      301 acagcctgaa ccccctgcac gcccagccgc agccgcagca cccaggctgg cccggccaga
      361 ggcagagcca ggagtctggg ctcctgcaca cgcaccgggg gctgcctcac cagctgtcgg
      421 gcctggatcc tcgcagggac tacaggcggc acgaggacct cctgcacggc ccacacgcgc
      481 tcagctcagg actcggagac ctctcgatcc actccttacc tcacgccatc gaggaggtcc
      541 cgcatgtaga agacccgggt attaacatcc cagatcaaac tgtaattaag aaaggccccg
      601 tgtccctgtc caagtccaac agcaatgccg tctccgccat ccctattaac aaggacaacc
      661 tcttcggcgg cgtggtgaac cccaacgaag tcttctgttc agttccgggt cgcctctcgc
      721 tcctcagctc cacctcgaag tacaaggtca cggtggcgga agtgcagcgg cggctctcac
      781 cacccgagtg tctcaacgcg tcgctgctgg gcggagtgct ccggagggcg aagtctaaaa
      841 atggaggaag atctttaaga gaaaaactgg acaaaatagg attaaatctg cctgcaggga
      901 gacgtaaagc tgccaacgtt accctgctca catcactagt agagggagaa gctgtccacc
      961 tagccaggga ctttgggtac gtgtgcgaaa ccgaatttcc tgccaaagca gtagctgaat
     1021 ttctcaaccg acaacattcc gatcccaatg agcaagtgac aagaaaaaac atgctcctgg
     1081 ctacaaaaca gatatgcaaa gagttcaccg acctgctggc tcaggaccga tctcccctgg
     1141 ggaactcacg gcccaacccc atcctggagc ccggcatcca gagctgcttg acccacttca
     1201 acctcatctc ccacggcttc ggcagccccg cggtgtgtgc cgcggtcacg gccctgcaga
     1261 actatctcac cgaggccctc aaggccatgg acaaaatgta cctcagcaac aaccccaaca
     1321 gccacacgga caacaacgcc aaaagcagtg acaaagagga gaagcacaga aagtgaggct
     1381 ctcctcccgc cccgcccctc ccacgcctca ccagcccccc gcgcgcccac cctccggcgg
     1441 gtgacagctc cgggatcagc aacccttcct gctgctgcta ctgctgctgc tgctgccgcc
     1501 gccgccgccg ccgctgccct tgggtccccc cgagtctccg ggactgccct ctcgactgtc
     1561 agtggggcag cctctccgac tctgcacccg cctcgacctc cccacccgct cccacacccc
     1621 tgtgcccccg gaattc
//