LOCUS       X52221                  2872 bp    mRNA    linear   HUM 23-OCT-2008
DEFINITION  H.sapiens ERCC2 gene, exons 1 & 2 (partial).
ACCESSION   X52221 X52470
VERSION     X52221.1
KEYWORDS    ATP-binding protein; DNA repair; DNA-binding protein; ERCC2 gene;
            excision repair gene.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2872)
  AUTHORS   Weber C.A.
  JOURNAL   Submitted (27-FEB-1990) to the INSDC. Weber C.A., Lawrence
            Livermore National Laboratory, Biomedical Sciences Division L452, P
            O Box 5507, Livermore Ca 94551, USA.
REFERENCE   2  (bases 1 to 2872)
  AUTHORS   Weber C.A., Salazar E.P., Stewart S.A., Thompson L.H.
  TITLE     ERCC2: cDNA cloning and molecular characterization of a human
            nucleotide excision repair gene with high homology to yeast RAD3
  JOURNAL   EMBO J. 9(5), 1437-1447(1990).
   PUBMED   2184031
COMMENT     Note sequence is compiled from both genomic and cDNA sources.
            Position 1-442 is derived mainly from genomic clones and sequence
            443-2872 is derived from cDNA clones.
            See <X52222> for 3'end of ERCC2.
FEATURES             Location/Qualifiers
     source          1..2872
                     /db_xref="H-InvDB:HIT000321738"
                     /organism="Homo sapiens"
                     /chromosome="19q13.2-q13.3"
                     /mol_type="mRNA"
                     /dev_stage="adult"
                     /clone_lib="pcD2"
                     /clone="pER2-14"
                     /cell_line="GM637"
                     /cell_type="fibroblast"
                     /db_xref="taxon:9606"
     misc_feature    100..133
                     /note="pyrimidine-rich region"
     regulatory      191..196
                     /regulatory_class="GC_signal"
     repeat_region   208..212
                     /rpt_type=INVERTED
                     /note="inverted repeat A"
     repeat_region   215..219
                     /rpt_type=INVERTED
                     /note="inverted repeat A'"
     regulatory      245..253
                     /regulatory_class="CAAT_signal"
     regulatory      276..282
                     /regulatory_class="TATA_box"
     mRNA            join(301..383,687..>2872)
     prim_transcript 301..2872
     exon            301..383
                     /number=1
     misc_feature    328..359
                     /note="minisatellite DNA"
     CDS             join(379..383,687..>2872)
                     /product="ercc2 gene product"
                     /db_xref="GOA:P18074"
                     /db_xref="H-InvDB:HIT000321738.13"
                     /db_xref="HGNC:HGNC:3434"
                     /db_xref="InterPro:IPR001945"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR006554"
                     /db_xref="InterPro:IPR006555"
                     /db_xref="InterPro:IPR010614"
                     /db_xref="InterPro:IPR010643"
                     /db_xref="InterPro:IPR013020"
                     /db_xref="InterPro:IPR014013"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PDB:5IVW"
                     /db_xref="PDB:5IY6"
                     /db_xref="PDB:5IY7"
                     /db_xref="PDB:5IY8"
                     /db_xref="PDB:5IY9"
                     /db_xref="PDB:5OF4"
                     /db_xref="UniProtKB/Swiss-Prot:P18074"
                     /protein_id="CAA36463.1"
                     /translation="MKLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPS
                     GTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKL
                     PFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEE
                     FDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIA
                     DLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKET
                     DEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLR
                     RLLEYVKWRLRVQHVVQESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLA
                     DFSPLTLLANFATLVSTYAKGFTIIIEPFDDRTPTIANPILHFSCMDASLAIKPVFER
                     FQSVIITSGTLSPLDIYPKILDFHPVTMATFTMTLARVCLCPMIIGRGNDQVAISSKF
                     ETREDIAVIRNYGNLLLEMSAVVPDGIVAFFTSYQYMESTVASWYEQGILENIQRNKL
                     LFIETQDGAETSVALEKYQEACENGRGAILLSVARGKVSEGIDFVHHYGRAVIMFGVP
                     YVYTQSRILKARLEYLRDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADK
                     RFARGDKRGKLPRWIQEHLTDANLNLTVDEGVQVAKYFLRQMAQPFHR"
     misc_feature    383..409
                     /note="partial minisatellite DNA"
     intron          384..686
                     /number=1
     misc_feature    414..436
                     /note="partial minisatellite DNA"
     misc_feature    626..663
                     /note="minisatellite DNA"
     misc_feature    664..693
                     /note="minisatellite DNA"
     exon            687..>2872
                     /number=2
BASE COUNT          560 a          888 c          871 g          553 t
ORIGIN      
        1 gctatcttgc tcaagctgat ctcgaactcc tgggttcgat caatactcag acaatcttgg
       61 caggcgcagg aggaccaaat tctagtgaat gagatcgagt ctctcggctc tttcccttcc
      121 atgttttctt tttgattggc cctcgacgat cctcagtgac gcctcccgca ccgcctcacc
      181 cgagagtcag ccgccctcgc ttttccgtgc gcacgcgcag tatcccgatt ggctctgccc
      241 tagcggattg acgggcaggt tagccaatgg tctcgtaata taggtggagc gagccctcga
      301 ggatgtccac gacccggcct ctcgctgaat attcatgagg gaggcgggtc gaccccgctg
      361 cacagtccgg ccggcgccat gaagtgagaa gggggctggg ggtcgcgctc gctagcgggc
      421 gcggggggtc ttgaagatgg ggtcatcggt gggcgcgcct gggtccccaa gggggcgagg
      481 ggagggtgaa ggggtgggac gggggcagcc gcagggagca gcagtgatag cgaggagaca
      541 ctgagggggc cccgaggctc ctgaggacct gagggttacc gggggcgccg ggcccgtcac
      601 ccttctctgg gctcgacgac cgggcactgt ggaggcggga gaggggctga ggggacggga
      661 actgacccag cagcccctgc cgccaggctc aacgtggacg ggctcctggt ctacttcccg
      721 tacgactaca tctaccccga gcagttctcc tacatgcggg agctcaaacg cacgctggac
      781 gccaagggtc atggagtcct ggagatgccc tcaggcaccg ggaagacagt atccctgttg
      841 gccctgatca tggcatacca gagagcatat ccgctggagg tgaccaaact catctactgc
      901 tcaagaactg tgccagagat tgagaaggtg attgaagagc ttcgaaagtt gctcaacttc
      961 tatgagaagc aggagggcga gaagctgccg tttctgggac tggctctgag ctcccgcaaa
     1021 aacttgtgta ttcaccctga ggtgacaccc ctgcgctttg ggaaggacgt cgatgggaaa
     1081 tgccacagcc tcacagcctc ctatgtgcgg gcgcagtacc agcatgacac cagcctgccc
     1141 cactgccgat tctatgagga atttgatgcc catgggcgtg aggtgcccct ccccgctggc
     1201 atctacaacc tggatgacct gaaggccctg gggcggcgcc agggctggtg cccatacttc
     1261 cttgctcgat actcaatcct gcatgccaat gtggtggttt atagctacca ctacctcctg
     1321 gaccccaaga ttgcagacct ggtgtccaag gaactggccc gcaaggccgt cgtggtcttc
     1381 gacgaggccc acaacattga caacgtctgc atcgactcca tgagcgtcaa cctcacccgc
     1441 cggacccttg accggtgcca gggcaacctg gagaccctgc agaagacggt gctcaggatc
     1501 aaagagacag acgagcagcg cctgcgggac gagtaccggc gtctggtgga ggggctgcgg
     1561 gaggccagcg ccgcccggga gacggacgcc cacctggcca accccgtgct gcccgacgaa
     1621 gtgctgcagg aggcagtgcc tggctccatc cgcacggccg agcatttcct gggcttcctg
     1681 aggcggctgc tggagtacgt gaagtggcgg ctgcgtgtgc agcatgtggt gcaggagagc
     1741 ccgcccgcct tcctgagcgg cctggcccag cgcgtgtgca tccagcgcaa gcccctcaga
     1801 ttctgtgctg aacgcctccg gtccctgctg catactctgg agatcaccga ccttgctgac
     1861 ttctccccgc tcaccctcct tgctaacttt gccacccttg tcagcaccta cgccaaaggc
     1921 ttcaccatca tcatcgagcc ctttgacgac agaaccccga ccattgccaa ccccatcctg
     1981 cacttcagct gcatggacgc ctcgctggcc atcaaacccg tatttgagcg tttccagtct
     2041 gtcatcatca catctgggac actgtccccg ctggacatct accccaagat cctggacttc
     2101 caccccgtca ccatggcaac cttcaccatg acgctggcac gggtctgcct ctgccctatg
     2161 atcatcggcc gtggcaatga ccaggtggcc atcagctcca aatttgagac ccgggaggat
     2221 attgctgtga tccggaacta tgggaacctc ctgctggaga tgtccgctgt ggtccctgat
     2281 ggcatcgtgg ccttcttcac cagctaccag tacatggaga gcaccgtggc ctcctggtat
     2341 gagcagggga tccttgagaa catccagagg aacaagctgc tctttattga gacccaggat
     2401 ggtgccgaaa ccagtgtcgc cctggagaag taccaggagg cctgcgagaa tggccgcggg
     2461 gccatcctgc tgtcagtggc ccggggcaaa gtgtccgagg gaatcgactt tgtgcaccac
     2521 tacgggcggg ccgtcatcat gtttggcgtc ccctacgtct acacacagag ccgcattctc
     2581 aaggcgcggc tggaatacct gcgggaccag ttccagattc gtgagaatga ctttcttacc
     2641 ttcgatgcca tgcgccacgc ggcccagtgt gtgggtcggg ccatcagggg caagacggac
     2701 tacggcctca tggtctttgc cgacaagcgg tttgcccgtg gggacaagcg ggggaagctg
     2761 ccccgctgga tccaggagca cctcacagat gccaacctca acctgaccgt ggacgagggt
     2821 gtccaggtgg ccaagtactt cctgcggcag atggcacagc ccttccaccg gg
//