LOCUS       X15998                  8224 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  H.sapiens mRNA for the chondroitin sulphate proteoglycan versican,
            V1 splice-variant; precursor peptide.
ACCESSION   X15998 X16626
VERSION     X15998.1
KEYWORDS    chondroitin sulfate proteoglycan; chondroitin sulfate proteoglycan
            core protein; glycoprotein; proteoglycan; transmembrane
            glycoprotein; versican.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 8224)
  AUTHORS   Zimmermann D.R.
  JOURNAL   Submitted (02-AUG-1989) to the INSDC. Zimmermann D.R., La Jolla
            Cancer Research Foundation, 10901 North Torrey Pines Rd, La Jolla
            CA92037, U S A.
REFERENCE   2  (bases 1 to 8224)
  AUTHORS   Zimmermann D.R., Ruoslahti E.
  TITLE     Multiple domains of the large fibroblast proteoglycan, versican
  JOURNAL   EMBO J. 8(10), 2975-2981(1989).
   PUBMED   2583089
COMMENT     see <J02814> for overlapping sequence
FEATURES             Location/Qualifiers
     source          1..8224
                     /db_xref="H-InvDB:HIT000321534"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /clone="A-F,1A,4A,2B."
                     /cell_type="fibroblast"
                     /tissue_type="placenta"
                     /db_xref="taxon:9606"
     CDS             267..7496
                     /note="precursor peptide (AA -20 to 2389)"
                     /db_xref="GOA:P13611"
                     /db_xref="H-InvDB:HIT000321534.13"
                     /db_xref="HGNC:HGNC:2464"
                     /db_xref="InterPro:IPR000152"
                     /db_xref="InterPro:IPR000436"
                     /db_xref="InterPro:IPR000538"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR001304"
                     /db_xref="InterPro:IPR001881"
                     /db_xref="InterPro:IPR003599"
                     /db_xref="InterPro:IPR007110"
                     /db_xref="InterPro:IPR013032"
                     /db_xref="InterPro:IPR013106"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR016186"
                     /db_xref="InterPro:IPR016187"
                     /db_xref="InterPro:IPR018097"
                     /db_xref="InterPro:IPR018378"
                     /db_xref="InterPro:IPR033987"
                     /db_xref="UniProtKB/Swiss-Prot:P13611"
                     /protein_id="CAA34128.1"
                     /translation="MFINIKSILWMCSTLIVTHALHKVKVGKSPPVRGSLSGKVSLPC
                     HFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVS
                     VPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSR
                     YTLNFEAAQKACLDVGAVIATPEQLFAAYEDGFEQCDAGWLADQTVRYPIRAPRVGCY
                     GDKMGKAGVRTYGFRSPQETYDVYCYVDHLDGDVFHLTVPSKFTFEEAAKECENQDAR
                     LATVGELQAAWRNGFDQCDYGWLSDASVRHPVTVARAQCGGGLLGVRTLYRFENQTGF
                     PPPDSRFDAYCFKRRMSDLSVIGHPIDSESKEDEPCSEETDPVHDLMAEILPEFPDII
                     EIDLYHSEENEEEEEECANATDVTTTPSVQYINGKHLVTTVPKDPEAAEARRGQFESV
                     APSQNFSDSSESDTHPFVIAKTELSTAVQPNESTETTESLEVTWKPETYPETSEHFSG
                     GEPDVFPTVPFHEEFESGTAKKGAESVTERDTEVGHQAHEHTEPVSLFPEESSGEIAI
                     DQESQKIAFARATEVTFGEEVEKSTSVTYTPTIVPSSASAYVSEEEAVTLIGNPWPDD
                     LLSTKESWVEATPRQVVELSGSSSIPITEGSGEAEEDEDTMFTMVTDLSQRNTTDTLI
                     TLDTSRIITESFFEVPATTIYPVSEQPSAKVVPTKFVSETDTSEWISSTTVEEKKRKE
                     EEGTTGTASTFEVYSSTQRSDQLILPFELESPNVATSSDSGTRKSFMSLTTPTQSERE
                     MTDSTPVFTETNTLENLGAQTTEHSSIHQPGVQEGLTTLPRSPASVFMEQGSGEAAAD
                     PETTTVSSFSLNVEYAIQAEKEVAGTLSPHVETTFSTEPTGLVLSTVMDRVVAENITQ
                     TSREIVISERLGEPNYGAEIRGFSTGFPLEEDFSGDFREYSTVSHPIAKEETVMMEGS
                     GDAAFRDTQTSPSTVPTSVHISHISDSEGPSSTMVSTSAFPWEEFTSSAEGSGEQLVT
                     VSSSVVPVLPSAVQKFSGTASSIIDEGLGEVGTVNEIDRRSTILPTAEVEGTKAPVEK
                     EEVKVSGTVSTNFPQTIEPAKLWSRQEVNPVRQEIESETTSEEQIQEEKSFESPQNSP
                     ATEQTIFDSQTFTETELKTTDYSVLTTKKTYSDDKEMKEEDTSLVNMSTPDPDANGLE
                     SYTTLPEATEKSHFFLATALVTESIPAEHVVTDSPIKKEESTKHFPKGMRPTIQESDT
                     ELLFSGLGSGEEVLPTLPTESVNFTEVEQINNTLYPHTSQVESTSSDKIEDFNRMENV
                     AKEVGPLVSQTDIFEGSGSVTSTTLIEILSDTGAEGPTVAPLPFSTDIGHPQNQTVRW
                     AEEIQTSRPQTITEQDSNKNSSTAEINETTTSSTDFLARAYGFEMAKEFVTSAPKPSD
                     LYYEPSGEGSGEVDIVDSFHTSATTQATRQESSTTFVSDGSLEKHPEVPSAKAVTADG
                     FPTVSVMLPLHSEQNKSSPDPTSTLSNTVSYERSTDGSFQDRFREFEDSTLKPNRKKP
                     TENIIIDLDKEDKDLILTITESTILEILPELTSDKNTIIDIDHTKPVYEDILGMQTDI
                     DTEVPSEPHDSNDESNDDSTQVQEIYEAAVNLSLTEETFEGSADVLASYTQATHDESM
                     TYEDRSQLDHMGFHFTTGIPAPSTETELDVLLPTATSLPIPRKSATVIPEIEGIKAEA
                     KALDDMFESSTLSDGQAIADQSEIIPTLGQFERTQEEYEDKKHAGPSFQPEFSSGAEE
                     ALVDHTPYLSIATTHLMDQSVTEVPDVMEGSNPPYYTDTTLAVSTFAKLSSQTPSSPL
                     TIYSGSEASGHTEIPQPSALPGIDVGSSVMSPQDSFKEIHVNIEATFKPSSEEYLHIT
                     EPPSLSPDTKLEPSEDDGKPELLEEMEASPTELIAVEGTEILQDFQNKTDGQVSGEAI
                     KMFPTIKTPEAGTVITTADEIELEGATQWPHSTSASATYGVEAGVVPWLSPQTSERPT
                     LSSSPEINPETQAALIRGQDSTIAASEQQVAARILDSNDQATVNPVEFNTEVATPPFS
                     LLETSNETDFLIGINEESVEGTAIYLPGPDRCKMNPCLNGGTCYPTETSYVCTCVPGY
                     SGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQ
                     GQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEH
                     DFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGT
                     VACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKIT
                     CMNPSAYQRTYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR"
     sig_peptide     267..326
                     /note="signal peptide (AA -20 to -1)"
     mat_peptide     327..7493
                     /note="mature versican (AA 1-2389)"
     variation       1378
                     /replace="t"
                     /note="agt (S) is att (T) in clone E"
BASE COUNT         2524 a         1842 c         1797 g         2061 t
ORIGIN      
        1 gctgccccga gcctttctgg ggaagaactc caggcgtgcg gacgcaacag ccgagaacat
       61 taggtgttgt ggacaggagc tgggaccaag atcttcggcc agccccgcat cctcccgcat
      121 cttccagcac cgtcccgcac cctccgcatc cttccccggg ccaccacgct tcctatgtga
      181 cccgcctggg caacgccgaa cccagtcgcg cagcgctgca gtgaattttc cccccaaact
      241 gcaataagcc gccttccaag gccaagatgt tcataaatat aaagagcatc ttatggatgt
      301 gttcaacctt aatagtaacc catgcgctac ataaagtcaa agtgggaaaa agcccaccgg
      361 tgaggggctc cctctctgga aaagtcagcc taccttgtca tttttcaacg atgcctactt
      421 tgccacccag ttacaacacc agtgaatttc tccgcatcaa atggtctaag attgaagtgg
      481 acaaaaatgg aaaagatttg aaagagacta ctgtccttgt ggcccaaaat ggaaatatca
      541 agattggtca ggactacaaa gggagagtgt ctgtgcccac acatcccgag gctgtgggcg
      601 atgcctccct cactgtggtc aagctgctgg caagtgatgc gggtctttac cgctgtgacg
      661 tcatgtacgg gattgaagac acacaagaca cggtgtcact gactgtggat ggggttgtgt
      721 ttcactacag ggcggcaacc agcaggtaca cactgaattt tgaggctgct cagaaggctt
      781 gtttggacgt tggggcagtc atagcaactc cagagcagct ctttgctgcc tatgaagatg
      841 gatttgagca gtgtgacgca ggctggctgg ctgatcagac tgtcagatat cccatccggg
      901 ctcccagagt aggctgttat ggagataaga tgggaaaggc aggagtcagg acttatggat
      961 tccgttctcc ccaggaaact tacgatgtgt attgttatgt ggatcatctg gatggtgatg
     1021 tgttccacct cactgtcccc agtaaattca ccttcgagga ggctgcaaaa gagtgtgaaa
     1081 accaggatgc caggctggca acagtggggg aactccaggc ggcatggagg aacggctttg
     1141 accagtgcga ttacgggtgg ctgtcggatg ccagcgtgcg ccaccctgtg actgtggcca
     1201 gggcccagtg tggaggtggt ctacttgggg tgagaaccct gtatcgtttt gagaaccaga
     1261 caggcttccc tccccctgat agcagatttg atgcctactg ctttaaacgt cgaatgagtg
     1321 atttgagtgt aattggtcat ccaatagatt cagaatctaa agaagatgaa ccttgtagtg
     1381 aagaaacaga tccagtgcat gatctaatgg ctgaaatttt acctgaattc cctgacataa
     1441 ttgaaataga cctataccac agtgaagaaa atgaagaaga agaagaagag tgtgcaaatg
     1501 ctactgatgt gacaaccacc ccatctgtgc agtacataaa tgggaagcat ctcgttacca
     1561 ctgtgcccaa ggacccagaa gctgcagaag ctaggcgtgg ccagtttgaa agtgttgcac
     1621 cttctcagaa tttctcggac agctctgaaa gtgatactca tccatttgta atagccaaaa
     1681 cggaattgtc tactgctgtg caacctaatg aatctacaga aacaactgag tctcttgaag
     1741 ttacatggaa gcctgagact taccctgaaa catcagaaca tttttcaggt ggtgagcctg
     1801 atgttttccc cacagtccca ttccatgagg aatttgaaag tggaacagcc aaaaaagggg
     1861 cagaatcagt cacagagaga gatactgaag ttggtcatca ggcacatgaa catactgaac
     1921 ctgtatctct gtttcctgaa gagtcttcag gagagattgc cattgaccaa gaatctcaga
     1981 aaatagcctt tgcaagggct acagaagtaa catttggtga agaggtagaa aaaagtactt
     2041 ctgtcacata cactcccact atagttccaa gttctgcatc agcatatgtt tcagaggaag
     2101 aagcagttac cctaatagga aatccttggc cagatgacct gttgtctacc aaagaaagct
     2161 gggtagaagc aactcctaga caagttgtag agctctcagg gagttcttcg attccaatta
     2221 cagaaggctc tggagaagca gaagaagatg aagatacaat gttcaccatg gtaactgatt
     2281 tatcacagag aaatactact gatacactca ttactttaga cactagcagg ataatcacag
     2341 aaagcttttt tgaggttcct gcaaccacca tttatccagt ttctgaacaa ccttctgcaa
     2401 aagtggtgcc taccaagttt gtaagtgaaa cagacacttc tgagtggatt tccagtacca
     2461 ctgttgagga aaagaaaagg aaggaggagg agggaactac aggtacggct tctacatttg
     2521 aggtatattc atctacacag agatcggatc aattaatttt accctttgaa ttagaaagtc
     2581 caaatgtagc tacatctagt gattcaggta ccaggaaaag ttttatgtcc ttgacaacac
     2641 caacacagtc tgaaagggaa atgacagatt ctactcctgt ctttacagaa acaaatacat
     2701 tagaaaattt gggggcacag accactgagc acagcagtat ccatcaacct ggggttcagg
     2761 aagggctgac cactctccca cgtagtcctg cctctgtctt tatggagcag ggctctggag
     2821 aagctgctgc cgacccagaa accaccactg tttcttcatt ttcattaaac gtagagtatg
     2881 caattcaagc cgaaaaggaa gtagctggca ctttgtctcc gcatgtggaa actacattct
     2941 ccactgagcc aacaggactg gttttgagta cagtaatgga cagagtagtt gctgaaaata
     3001 taacccaaac atccagggaa atagtgattt cagagcgatt aggagaacca aattatgggg
     3061 cagaaataag gggcttttcc acaggttttc ctttggagga agatttcagt ggtgacttta
     3121 gagaatactc aacagtgtct catcccatag caaaagaaga aacggtaatg atggaaggct
     3181 ctggagatgc agcatttagg gacacccaga cttcaccatc tacagtacct acttcagttc
     3241 acatcagtca catatctgac tcagaaggac ccagtagcac catggtcagc acttcagcct
     3301 tcccctggga agagtttaca tcctcagctg agggctcagg tgagcaactg gtcacagtca
     3361 gcagctctgt tgttccagtg cttcccagtg ctgtgcaaaa gttttctggt acagcttcct
     3421 ccattatcga cgaaggattg ggagaagtgg gtactgtcaa tgaaattgat agaagatcca
     3481 ccattttacc aacagcagaa gtggaaggta cgaaagctcc agtagagaag gaggaagtaa
     3541 aggtcagtgg cacagtttca acaaactttc cccaaactat agagccagcc aaattatggt
     3601 ctaggcaaga agtcaaccct gtaagacaag aaattgaaag tgaaacaaca tcagaggaac
     3661 aaattcaaga agaaaagtca tttgaatccc ctcaaaactc tcctgcaaca gaacaaacaa
     3721 tctttgattc acagacattt actgaaactg aactcaaaac cacagattat tctgtactaa
     3781 caacaaagaa aacttacagt gatgataaag aaatgaagga ggaagacact tctttagtta
     3841 acatgtctac tccagatcca gatgcaaatg gcttggaatc ttacacaact ctccctgaag
     3901 ctactgaaaa gtcacatttt ttcttagcta ctgcattagt aactgaatct ataccagctg
     3961 aacatgtagt cacagattca ccaatcaaaa aggaagaaag tacaaaacat tttccgaaag
     4021 gcatgagacc aacaattcaa gagtcagata ctgagctctt attctctgga ctgggatcag
     4081 gagaagaagt tttacctact ctaccaacag agtcagtgaa ttttactgaa gtggaacaaa
     4141 tcaataacac attatatccc cacacttctc aagtggaaag tacctcaagt gacaaaattg
     4201 aagactttaa cagaatggaa aatgtggcaa aagaagttgg accactcgta tctcaaacag
     4261 acatctttga aggtagtggg tcagtaacca gcacaacatt aatagaaatt ttaagtgaca
     4321 ctggagcaga aggacccacg gtggcacctc tccctttctc cacggacatc ggacatcctc
     4381 aaaatcagac tgtcaggtgg gcagaagaaa tccagactag tagaccacaa accataactg
     4441 aacaagactc taacaagaat tcttcaacag cagaaattaa cgaaacaaca acctcatcta
     4501 ctgattttct ggctagagct tatggttttg aaatggccaa agaatttgtt acatcagcac
     4561 caaaaccatc tgacttgtat tatgaacctt ctggagaagg atctggagaa gtggatattg
     4621 ttgattcatt tcacacttct gcaactactc aggcaaccag acaagaaagc agcaccacat
     4681 ttgtttctga tgggtccctg gaaaaacatc ctgaggtgcc aagcgctaaa gctgttactg
     4741 ctgatggatt cccaacagtt tcagtgatgc tgcctcttca ttcagagcag aacaaaagct
     4801 cccctgatcc aactagcaca ctgtcaaata cagtgtcata tgagaggtcc acagacggta
     4861 gtttccaaga ccgtttcagg gaattcgagg attccacctt aaaacctaac agaaaaaaac
     4921 ccactgaaaa tattatcata gacctggaca aagaggacaa ggatttaata ttgacaatta
     4981 cagagagtac catccttgaa attctacctg agctgacatc ggataaaaat actatcatag
     5041 atattgatca tactaaacct gtgtatgaag acattcttgg aatgcaaaca gatatagata
     5101 cagaggtacc atcagaacca catgacagta atgatgaaag taatgatgac agcactcaag
     5161 ttcaagagat ctatgaggca gctgtcaacc tttctttaac tgaggaaaca tttgagggct
     5221 ctgctgatgt tctggctagc tacactcagg caacacatga tgaatcaatg acttatgaag
     5281 atagaagcca actagatcac atgggctttc acttcacaac tgggatccct gctcctagca
     5341 cagaaacaga attagacgtt ttacttccca cggcaacatc cctgccaatt cctcgtaagt
     5401 ctgccacagt tattccagag attgaaggaa taaaagctga agcaaaagcc ctggatgaca
     5461 tgtttgaatc aagcactttg tctgatggtc aagctattgc agaccaaagt gaaataatac
     5521 caacattggg ccaatttgaa aggactcagg aggagtatga agacaaaaaa catgctggtc
     5581 cttcttttca gccagaattc tcttcaggag ctgaggaggc attagtagac catactccct
     5641 atctaagtat tgctactacc caccttatgg atcagagtgt aacagaggtg cctgatgtga
     5701 tggaaggatc caatccccca tattacactg atacaacatt agcagtttca acatttgcga
     5761 agttgtcttc tcagacacca tcatctcccc tcactatcta ctcaggcagt gaagcctctg
     5821 gacacacaga gatcccccag cccagtgctc tgccaggaat agacgtcggc tcatctgtaa
     5881 tgtccccaca ggattctttt aaggaaattc atgtaaatat tgaagcaact ttcaaaccat
     5941 caagtgagga ataccttcac ataactgagc ctccctcttt atctcctgac acaaaattag
     6001 aaccttcaga agatgatggt aaacctgagt tattagaaga aatggaagct tctcccacag
     6061 aacttattgc tgtggaagga actgagattc tccaagattt ccaaaacaaa accgatggtc
     6121 aagtttctgg agaagcaatc aagatgtttc ccaccattaa aacacctgag gctggaactg
     6181 ttattacaac tgccgatgaa attgaattag aaggtgctac acagtggcca cactctactt
     6241 ctgcttctgc cacctatggg gtcgaggcag gtgtggtgcc ttggctaagt ccacagactt
     6301 ctgagaggcc cacgctttct tcttctccag aaataaaccc tgaaactcaa gcagctttaa
     6361 tcagagggca ggattccacg atagcagcat cagaacagca agtggcagcg agaattcttg
     6421 attccaatga tcaggcaaca gtaaaccctg tggaatttaa tactgaggtt gcaacaccac
     6481 cattttccct tctggagact tctaatgaaa cagatttcct gattggcatt aatgaagagt
     6541 cagtggaagg cacggcaatc tatttaccag gacctgatcg ctgcaaaatg aacccgtgcc
     6601 ttaacggagg cacctgttat cctactgaaa cttcctacgt atgcacctgt gtgccaggat
     6661 acagcggaga ccagtgtgaa cttgattttg atgaatgtca ctctaatccc tgtcgtaatg
     6721 gagccacttg tgttgatggt tttaacacat tcaggtgcct ctgccttcca agttatgttg
     6781 gtgcactttg tgagcaagat accgagacat gtgactatgg ctggcacaaa ttccaagggc
     6841 agtgctacaa atactttgcc catcgacgca catgggatgc agctgaacgg gaatgccgtc
     6901 tgcagggtgc ccatctcaca agcatcctgt ctcacgaaga acaaatgttt gttaatcgtg
     6961 tgggccatga ttatcagtgg ataggcctca atgacaagat gtttgagcat gacttccgtt
     7021 ggactgatgg cagcacactg caatacgaga attggagacc caaccagcca gacagcttct
     7081 tttctgctgg agaagactgt gttgtaatca tttggcatga gaatggccag tggaatgatg
     7141 ttccctgcaa ttaccatctc acctatacgt gcaagaaagg aacagttgct tgcggccagc
     7201 cccctgttgt agaaaatgcc aagacctttg gaaagatgaa acctcgttat gaaatcaact
     7261 ccctgattag ataccactgc aaagatggtt tcattcaacg tcaccttcca actatccggt
     7321 gcttaggaaa tggaagatgg gctataccta aaattacctg catgaaccca tctgcatacc
     7381 aaaggactta ttctatgaaa tactttaaaa attcctcatc agcaaaggac aattcaataa
     7441 atacatccaa acatgatcat cgttggagcc ggaggtggca ggagtcgagg cgctgatccc
     7501 taaaatggcg aacatgtgtt ttcatcattt cagccaaagt cctaacttcc tgtgcctttc
     7561 ctatcacctc gagaagtaat tatcagttgg tttggatttt tggaccaccg ttcagtcatt
     7621 ttgggttgcc gtgctcccaa aacattttaa atgaaagtat tggcattcaa aaagacagca
     7681 gacaaaatga aagaaaatga gagcagaaag taagcatttc cagcctatct aatttcttta
     7741 gttttctatt tgcctccagt gcagtccatt tcctaatgta taccagccta ctgtactatt
     7801 taaaatgctc aatttcagca ccgatggcca tgtaaataag atgatttaat gttgatttta
     7861 atcctgtata taaaataaaa agtcacaatg agtttgggca tatttaatga tgattatgga
     7921 gccttagagg tctttaatca ttggttcggc tgcttttatg tagtttaggc tggaaatggt
     7981 ttcacttgct ctttgactgt cagcaagact gaagatggct tttcctggac agctagaaaa
     8041 cacaaaatct tgtaggtcat tgcacctatc tcagccatag gtgcagtttg cttctacatg
     8101 atgctaaagg ctgcgaatgg gatcctgatg gaactaagga ctccaatgtc gaactcttct
     8161 ttgctgcatt cctttttctt cacttacaag aaaggcctga atggaggact tttctgtaac
     8221 cagg
//